BLASTX nr result
ID: Chrysanthemum21_contig00012887
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00012887 (510 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KVH92168.1| Nuclear fragile X mental retardation-interacting ... 60 3e-07 ref|XP_021981899.1| uncharacterized protein LOC110877967 isoform... 59 7e-07 ref|XP_021981897.1| uncharacterized protein LOC110877967 isoform... 59 7e-07 >gb|KVH92168.1| Nuclear fragile X mental retardation-interacting protein 1, conserved domain-containing protein [Cynara cardunculus var. scolymus] Length = 627 Score = 59.7 bits (143), Expect = 3e-07 Identities = 31/49 (63%), Positives = 32/49 (65%), Gaps = 5/49 (10%) Frame = -3 Query: 241 NHGNVPGNIGG-WVESLHKNSTGHKTNDASVKGFKSH----KHVKEKFG 110 NHGN+P N W ES KN TGHK ND S KGFKS KHVKEKFG Sbjct: 320 NHGNIPANGNAKWTESQRKNFTGHKRNDLSHKGFKSQFQHAKHVKEKFG 368 >ref|XP_021981899.1| uncharacterized protein LOC110877967 isoform X2 [Helianthus annuus] gb|OTG14519.1| hypothetical protein HannXRQ_Chr09g0250361 [Helianthus annuus] Length = 495 Score = 58.5 bits (140), Expect = 7e-07 Identities = 27/45 (60%), Positives = 30/45 (66%), Gaps = 1/45 (2%) Frame = -3 Query: 241 NHGNVPGNI-GGWVESLHKNSTGHKTNDASVKGFKSHKHVKEKFG 110 NH + P N+ GGW E HK TGHKT D S KG K HKH K+KFG Sbjct: 212 NHKSGPTNVNGGWTEGQHKKFTGHKTYDPSQKGSKIHKHAKQKFG 256 >ref|XP_021981897.1| uncharacterized protein LOC110877967 isoform X1 [Helianthus annuus] ref|XP_021981898.1| uncharacterized protein LOC110877967 isoform X1 [Helianthus annuus] Length = 496 Score = 58.5 bits (140), Expect = 7e-07 Identities = 27/45 (60%), Positives = 30/45 (66%), Gaps = 1/45 (2%) Frame = -3 Query: 241 NHGNVPGNI-GGWVESLHKNSTGHKTNDASVKGFKSHKHVKEKFG 110 NH + P N+ GGW E HK TGHKT D S KG K HKH K+KFG Sbjct: 212 NHKSGPTNVNGGWTEGQHKKFTGHKTYDPSQKGSKIHKHAKQKFG 256