BLASTX nr result
ID: Chrysanthemum21_contig00012755
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00012755 (550 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PLY76782.1| hypothetical protein LSAT_4X108221 [Lactuca sativa] 53 4e-06 >gb|PLY76782.1| hypothetical protein LSAT_4X108221 [Lactuca sativa] Length = 77 Score = 52.8 bits (125), Expect = 4e-06 Identities = 24/36 (66%), Positives = 29/36 (80%) Frame = +2 Query: 53 VQNVTRIPRKRSRNGIGMVVIEI*QDELMKNRPRED 160 +QN+TR+P KR RN I +IE+ QDELMKNRPRED Sbjct: 11 IQNMTRVPGKRGRNEIPHEIIEVSQDELMKNRPRED 46