BLASTX nr result
ID: Chrysanthemum21_contig00012617
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00012617 (432 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_021976126.1| zinc finger transcription factor YY1 isoform... 59 2e-07 ref|XP_021976127.1| zinc finger transcription factor YY1 isoform... 59 2e-07 ref|XP_021976125.1| zinc finger transcription factor YY1 isoform... 59 2e-07 gb|KVI05634.1| Zinc finger, C2H2 [Cynara cardunculus var. scolymus] 57 1e-06 >ref|XP_021976126.1| zinc finger transcription factor YY1 isoform X2 [Helianthus annuus] Length = 388 Score = 59.3 bits (142), Expect = 2e-07 Identities = 30/45 (66%), Positives = 32/45 (71%), Gaps = 1/45 (2%) Frame = +1 Query: 1 KNTSRXXXXXXGDMDAGSDHD-VYAVKRGNTNSQKQNRPKPNIRL 132 KN R DMDAGSDHD YAVKRGNT SQK +RPKPNI+L Sbjct: 274 KNAPRNKNNTDADMDAGSDHDGQYAVKRGNTKSQKPSRPKPNIKL 318 >ref|XP_021976127.1| zinc finger transcription factor YY1 isoform X3 [Helianthus annuus] Length = 388 Score = 59.3 bits (142), Expect = 2e-07 Identities = 30/45 (66%), Positives = 32/45 (71%), Gaps = 1/45 (2%) Frame = +1 Query: 1 KNTSRXXXXXXGDMDAGSDHD-VYAVKRGNTNSQKQNRPKPNIRL 132 KN R DMDAGSDHD YAVKRGNT SQK +RPKPNI+L Sbjct: 274 KNAPRNKNNTDADMDAGSDHDGQYAVKRGNTKSQKPSRPKPNIKL 318 >ref|XP_021976125.1| zinc finger transcription factor YY1 isoform X1 [Helianthus annuus] gb|OTG17162.1| putative zinc finger (C2H2 type) family protein [Helianthus annuus] Length = 389 Score = 59.3 bits (142), Expect = 2e-07 Identities = 30/45 (66%), Positives = 32/45 (71%), Gaps = 1/45 (2%) Frame = +1 Query: 1 KNTSRXXXXXXGDMDAGSDHD-VYAVKRGNTNSQKQNRPKPNIRL 132 KN R DMDAGSDHD YAVKRGNT SQK +RPKPNI+L Sbjct: 275 KNAPRNKNNTDADMDAGSDHDGQYAVKRGNTKSQKPSRPKPNIKL 319 >gb|KVI05634.1| Zinc finger, C2H2 [Cynara cardunculus var. scolymus] Length = 334 Score = 56.6 bits (135), Expect = 1e-06 Identities = 25/32 (78%), Positives = 27/32 (84%) Frame = +1 Query: 37 DMDAGSDHDVYAVKRGNTNSQKQNRPKPNIRL 132 DMDAGSDH+ YAVKRGN S KQNRPKP I+L Sbjct: 236 DMDAGSDHEGYAVKRGNAKSHKQNRPKPTIKL 267