BLASTX nr result
ID: Chrysanthemum21_contig00012574
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00012574 (562 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_022000942.1| carotenoid 9,10(9',10')-cleavage dioxygenase... 56 7e-06 >ref|XP_022000942.1| carotenoid 9,10(9',10')-cleavage dioxygenase 1-like [Helianthus annuus] gb|OTG01419.1| putative carotenoid oxygenase [Helianthus annuus] Length = 588 Score = 56.2 bits (134), Expect = 7e-06 Identities = 26/45 (57%), Positives = 33/45 (73%) Frame = +2 Query: 347 MVVCSINALLQVNCCAQRPSSVTNFDHFKNQLLSSFQVRFSSLSR 481 M C+I A+ QVNCCAQ+PSS+T F+ FKNQLLSSF+ L + Sbjct: 1 MAACNIKAI-QVNCCAQKPSSITTFEQFKNQLLSSFKPFIGDLQK 44