BLASTX nr result
ID: Chrysanthemum21_contig00012466
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00012466 (605 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_021973207.1| protein IQ-DOMAIN 1-like [Helianthus annuus]... 57 5e-06 >ref|XP_021973207.1| protein IQ-DOMAIN 1-like [Helianthus annuus] ref|XP_021973208.1| protein IQ-DOMAIN 1-like [Helianthus annuus] gb|OTG20672.1| putative IQ-domain 2 [Helianthus annuus] Length = 454 Score = 57.0 bits (136), Expect = 5e-06 Identities = 28/40 (70%), Positives = 32/40 (80%) Frame = +3 Query: 192 QSIRLVELTRYSGKTK*ETAATKIQTDFRGYLESRALRGL 311 +S+RL ELTRYSGK+K E AA +IQT FRGYL RALR L Sbjct: 107 ESVRLAELTRYSGKSKEEVAAIRIQTTFRGYLARRALRAL 146