BLASTX nr result
ID: Chrysanthemum21_contig00012382
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00012382 (479 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_021993020.1| endoplasmic reticulum oxidoreductin-1-like [... 77 2e-13 ref|XP_023765999.1| endoplasmic reticulum oxidoreductin-1-like [... 75 9e-13 ref|XP_013672419.1| endoplasmic reticulum oxidoreductin-1-like [... 72 2e-12 gb|KDO53449.1| hypothetical protein CISIN_1g0125551mg, partial [... 71 2e-12 ref|XP_017254945.1| PREDICTED: endoplasmic reticulum oxidoreduct... 73 4e-12 gb|KDO53448.1| hypothetical protein CISIN_1g0125551mg, partial [... 71 5e-12 gb|KDO53447.1| hypothetical protein CISIN_1g0125551mg, partial [... 71 5e-12 ref|XP_013613793.1| PREDICTED: endoplasmic reticulum oxidoreduct... 72 1e-11 gb|POO03235.1| Endoplasmic reticulum oxidoreductin [Trema orient... 72 1e-11 gb|PON67277.1| Endoplasmic reticulum oxidoreductin [Parasponia a... 72 1e-11 ref|XP_018452553.1| PREDICTED: endoplasmic reticulum oxidoreduct... 72 1e-11 ref|XP_013672417.1| endoplasmic reticulum oxidoreductin-1 [Brass... 72 1e-11 ref|XP_013613803.1| PREDICTED: endoplasmic reticulum oxidoreduct... 72 1e-11 ref|XP_009105886.1| PREDICTED: endoplasmic reticulum oxidoreduct... 72 1e-11 gb|AAT77872.1| putative endoplasmic reticulum oxidoreductin, 5'-... 69 1e-11 ref|XP_022560190.1| endoplasmic reticulum oxidoreductin-1-like [... 72 1e-11 gb|PNX78918.1| endoplasmic oxidoreductin-1-like protein, partial... 67 1e-11 dbj|BAF13089.2| Os03g0733800, partial [Oryza sativa Japonica Group] 69 2e-11 ref|XP_010414862.1| PREDICTED: endoplasmic reticulum oxidoreduct... 71 2e-11 gb|KNA06491.1| hypothetical protein SOVF_180620 isoform B [Spina... 71 2e-11 >ref|XP_021993020.1| endoplasmic reticulum oxidoreductin-1-like [Helianthus annuus] gb|OTG07401.1| putative ERO1-like protein beta [Helianthus annuus] Length = 474 Score = 77.0 bits (188), Expect = 2e-13 Identities = 34/43 (79%), Positives = 37/43 (86%) Frame = -1 Query: 131 SCELKLDEVELWQGQGGPILRKQIQNEFRNISALMDCVRCEKC 3 +C L E ELWQGQGGPILR+QIQN+FRNISALMDCV CEKC Sbjct: 339 ACALPFYEAELWQGQGGPILRQQIQNQFRNISALMDCVGCEKC 381 >ref|XP_023765999.1| endoplasmic reticulum oxidoreductin-1-like [Lactuca sativa] gb|PLY98300.1| hypothetical protein LSAT_7X99481 [Lactuca sativa] Length = 479 Score = 75.1 bits (183), Expect = 9e-13 Identities = 32/44 (72%), Positives = 38/44 (86%) Frame = -1 Query: 134 SSCELKLDEVELWQGQGGPILRKQIQNEFRNISALMDCVRCEKC 3 ++C L +E ELWQGQGGP+LR+QIQN+F NISALMDCV CEKC Sbjct: 340 AACALPFNEAELWQGQGGPMLRQQIQNQFLNISALMDCVGCEKC 383 >ref|XP_013672419.1| endoplasmic reticulum oxidoreductin-1-like [Brassica napus] Length = 199 Score = 72.0 bits (175), Expect = 2e-12 Identities = 30/44 (68%), Positives = 37/44 (84%) Frame = -1 Query: 134 SSCELKLDEVELWQGQGGPILRKQIQNEFRNISALMDCVRCEKC 3 ++C + DE +LWQGQGGP L++QIQ +FRNISALMDCV CEKC Sbjct: 64 TACPVPFDEAKLWQGQGGPELKQQIQKQFRNISALMDCVGCEKC 107 >gb|KDO53449.1| hypothetical protein CISIN_1g0125551mg, partial [Citrus sinensis] Length = 150 Score = 70.9 bits (172), Expect = 2e-12 Identities = 30/44 (68%), Positives = 36/44 (81%) Frame = -1 Query: 134 SSCELKLDEVELWQGQGGPILRKQIQNEFRNISALMDCVRCEKC 3 ++C L DE +LWQGQ GP L++QIQ +FRNISALMDCV CEKC Sbjct: 71 AACPLPFDEAKLWQGQSGPELKQQIQEQFRNISALMDCVGCEKC 114 >ref|XP_017254945.1| PREDICTED: endoplasmic reticulum oxidoreductin-1-like [Daucus carota subsp. sativus] ref|XP_017254948.1| PREDICTED: endoplasmic reticulum oxidoreductin-1-like [Daucus carota subsp. sativus] gb|KZM91566.1| hypothetical protein DCAR_021069 [Daucus carota subsp. sativus] gb|KZM91568.1| hypothetical protein DCAR_021067 [Daucus carota subsp. sativus] Length = 476 Score = 73.2 bits (178), Expect = 4e-12 Identities = 31/44 (70%), Positives = 37/44 (84%) Frame = -1 Query: 134 SSCELKLDEVELWQGQGGPILRKQIQNEFRNISALMDCVRCEKC 3 ++C L DE +LWQGQ GP L++QIQN+FRNISALMDCV CEKC Sbjct: 337 AACPLPFDEAKLWQGQNGPELKQQIQNQFRNISALMDCVGCEKC 380 >gb|KDO53448.1| hypothetical protein CISIN_1g0125551mg, partial [Citrus sinensis] Length = 206 Score = 70.9 bits (172), Expect = 5e-12 Identities = 30/44 (68%), Positives = 36/44 (81%) Frame = -1 Query: 134 SSCELKLDEVELWQGQGGPILRKQIQNEFRNISALMDCVRCEKC 3 ++C L DE +LWQGQ GP L++QIQ +FRNISALMDCV CEKC Sbjct: 71 AACPLPFDEAKLWQGQSGPELKQQIQEQFRNISALMDCVGCEKC 114 >gb|KDO53447.1| hypothetical protein CISIN_1g0125551mg, partial [Citrus sinensis] Length = 207 Score = 70.9 bits (172), Expect = 5e-12 Identities = 30/44 (68%), Positives = 36/44 (81%) Frame = -1 Query: 134 SSCELKLDEVELWQGQGGPILRKQIQNEFRNISALMDCVRCEKC 3 ++C L DE +LWQGQ GP L++QIQ +FRNISALMDCV CEKC Sbjct: 71 AACPLPFDEAKLWQGQSGPELKQQIQEQFRNISALMDCVGCEKC 114 >ref|XP_013613793.1| PREDICTED: endoplasmic reticulum oxidoreductin-1-like [Brassica oleracea var. oleracea] Length = 319 Score = 71.6 bits (174), Expect = 1e-11 Identities = 30/44 (68%), Positives = 37/44 (84%) Frame = -1 Query: 134 SSCELKLDEVELWQGQGGPILRKQIQNEFRNISALMDCVRCEKC 3 ++C + DE +LWQGQGGP L++QIQ +FRNISALMDCV CEKC Sbjct: 182 TACPVPFDEAKLWQGQGGPELKQQIQKKFRNISALMDCVGCEKC 225 >gb|POO03235.1| Endoplasmic reticulum oxidoreductin [Trema orientalis] Length = 468 Score = 72.0 bits (175), Expect = 1e-11 Identities = 31/44 (70%), Positives = 36/44 (81%) Frame = -1 Query: 134 SSCELKLDEVELWQGQGGPILRKQIQNEFRNISALMDCVRCEKC 3 ++C L DE +LWQGQ GP LR+QIQ +FRNISALMDCV CEKC Sbjct: 332 AACPLPFDEAKLWQGQSGPQLRQQIQKQFRNISALMDCVGCEKC 375 >gb|PON67277.1| Endoplasmic reticulum oxidoreductin [Parasponia andersonii] Length = 470 Score = 72.0 bits (175), Expect = 1e-11 Identities = 31/44 (70%), Positives = 36/44 (81%) Frame = -1 Query: 134 SSCELKLDEVELWQGQGGPILRKQIQNEFRNISALMDCVRCEKC 3 ++C L DE +LWQGQ GP LR+QIQ +FRNISALMDCV CEKC Sbjct: 332 AACPLPFDEAKLWQGQSGPQLRQQIQKQFRNISALMDCVGCEKC 375 >ref|XP_018452553.1| PREDICTED: endoplasmic reticulum oxidoreductin-1 [Raphanus sativus] Length = 471 Score = 72.0 bits (175), Expect = 1e-11 Identities = 30/44 (68%), Positives = 37/44 (84%) Frame = -1 Query: 134 SSCELKLDEVELWQGQGGPILRKQIQNEFRNISALMDCVRCEKC 3 ++C + DE +LWQGQGGP L++QIQ +FRNISALMDCV CEKC Sbjct: 336 TACPVPFDEAKLWQGQGGPELKQQIQKQFRNISALMDCVGCEKC 379 >ref|XP_013672417.1| endoplasmic reticulum oxidoreductin-1 [Brassica napus] ref|XP_013672418.1| endoplasmic reticulum oxidoreductin-1 [Brassica napus] ref|XP_022550937.1| endoplasmic reticulum oxidoreductin-1 [Brassica napus] Length = 471 Score = 72.0 bits (175), Expect = 1e-11 Identities = 30/44 (68%), Positives = 37/44 (84%) Frame = -1 Query: 134 SSCELKLDEVELWQGQGGPILRKQIQNEFRNISALMDCVRCEKC 3 ++C + DE +LWQGQGGP L++QIQ +FRNISALMDCV CEKC Sbjct: 336 TACPVPFDEAKLWQGQGGPELKQQIQKQFRNISALMDCVGCEKC 379 >ref|XP_013613803.1| PREDICTED: endoplasmic reticulum oxidoreductin-1 [Brassica oleracea var. oleracea] Length = 471 Score = 72.0 bits (175), Expect = 1e-11 Identities = 30/44 (68%), Positives = 37/44 (84%) Frame = -1 Query: 134 SSCELKLDEVELWQGQGGPILRKQIQNEFRNISALMDCVRCEKC 3 ++C + DE +LWQGQGGP L++QIQ +FRNISALMDCV CEKC Sbjct: 336 TACPVPFDEAKLWQGQGGPELKQQIQKQFRNISALMDCVGCEKC 379 >ref|XP_009105886.1| PREDICTED: endoplasmic reticulum oxidoreductin-1 [Brassica rapa] ref|XP_013649536.1| endoplasmic reticulum oxidoreductin-1 [Brassica napus] Length = 471 Score = 72.0 bits (175), Expect = 1e-11 Identities = 30/44 (68%), Positives = 37/44 (84%) Frame = -1 Query: 134 SSCELKLDEVELWQGQGGPILRKQIQNEFRNISALMDCVRCEKC 3 ++C + DE +LWQGQGGP L++QIQ +FRNISALMDCV CEKC Sbjct: 336 TACPVPFDEAKLWQGQGGPELKQQIQKQFRNISALMDCVGCEKC 379 >gb|AAT77872.1| putative endoplasmic reticulum oxidoreductin, 5'-partial, partial [Oryza sativa Japonica Group] Length = 159 Score = 68.9 bits (167), Expect = 1e-11 Identities = 28/44 (63%), Positives = 36/44 (81%) Frame = -1 Query: 134 SSCELKLDEVELWQGQGGPILRKQIQNEFRNISALMDCVRCEKC 3 S+C L DE +LWQG+ GP L+++IQ +FRNISA+MDCV CEKC Sbjct: 36 SACPLPFDEAKLWQGENGPELKQEIQKQFRNISAIMDCVGCEKC 79 >ref|XP_022560190.1| endoplasmic reticulum oxidoreductin-1-like [Brassica napus] Length = 374 Score = 71.6 bits (174), Expect = 1e-11 Identities = 30/44 (68%), Positives = 37/44 (84%) Frame = -1 Query: 134 SSCELKLDEVELWQGQGGPILRKQIQNEFRNISALMDCVRCEKC 3 ++C + DE +LWQGQGGP L++QIQ +FRNISALMDCV CEKC Sbjct: 237 TACPVPFDEAKLWQGQGGPELKQQIQKKFRNISALMDCVGCEKC 280 >gb|PNX78918.1| endoplasmic oxidoreductin-1-like protein, partial [Trifolium pratense] Length = 93 Score = 67.0 bits (162), Expect = 1e-11 Identities = 27/44 (61%), Positives = 37/44 (84%) Frame = -1 Query: 134 SSCELKLDEVELWQGQGGPILRKQIQNEFRNISALMDCVRCEKC 3 ++C + DE +LW+GQ GP L+++IQ++FRNISALMDCV CEKC Sbjct: 2 AACPVPFDEAKLWKGQSGPELKQKIQHQFRNISALMDCVGCEKC 45 >dbj|BAF13089.2| Os03g0733800, partial [Oryza sativa Japonica Group] Length = 178 Score = 68.9 bits (167), Expect = 2e-11 Identities = 28/44 (63%), Positives = 36/44 (81%) Frame = -1 Query: 134 SSCELKLDEVELWQGQGGPILRKQIQNEFRNISALMDCVRCEKC 3 S+C L DE +LWQG+ GP L+++IQ +FRNISA+MDCV CEKC Sbjct: 55 SACPLPFDEAKLWQGENGPELKQEIQKQFRNISAIMDCVGCEKC 98 >ref|XP_010414862.1| PREDICTED: endoplasmic reticulum oxidoreductin-1 [Camelina sativa] Length = 472 Score = 71.2 bits (173), Expect = 2e-11 Identities = 30/44 (68%), Positives = 37/44 (84%) Frame = -1 Query: 134 SSCELKLDEVELWQGQGGPILRKQIQNEFRNISALMDCVRCEKC 3 ++C + DEV+LWQGQ GP L++QIQ +FRNISALMDCV CEKC Sbjct: 332 TACPVPFDEVKLWQGQSGPELKQQIQKQFRNISALMDCVGCEKC 375 >gb|KNA06491.1| hypothetical protein SOVF_180620 isoform B [Spinacia oleracea] Length = 358 Score = 70.9 bits (172), Expect = 2e-11 Identities = 30/44 (68%), Positives = 36/44 (81%) Frame = -1 Query: 134 SSCELKLDEVELWQGQGGPILRKQIQNEFRNISALMDCVRCEKC 3 ++C L DE +LWQGQ GP L++QIQ +FRNISALMDCV CEKC Sbjct: 219 AACPLPFDEAKLWQGQSGPELKQQIQKQFRNISALMDCVGCEKC 262