BLASTX nr result
ID: Chrysanthemum21_contig00012235
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00012235 (410 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KVI07362.1| Mitochondrial carrier domain-containing protein [... 62 2e-08 ref|XP_023772597.1| probable mitochondrial adenine nucleotide tr... 60 6e-08 >gb|KVI07362.1| Mitochondrial carrier domain-containing protein [Cynara cardunculus var. scolymus] Length = 431 Score = 62.0 bits (149), Expect = 2e-08 Identities = 34/61 (55%), Positives = 41/61 (67%), Gaps = 5/61 (8%) Frame = -1 Query: 287 GLFLDNNNTLPHYILK-----NSTHFSSGHRSCSGGVFRPKDWILRNGFCSVSLSGKGSE 123 GLFLDNN TLPHY++ N+TH S HR+ GGVFR K+ + GF SVSLS KGS Sbjct: 33 GLFLDNN-TLPHYLINVVSPNNNTHHCSTHRTPGGGVFRQKNGVSGGGFLSVSLSVKGSS 91 Query: 122 N 120 + Sbjct: 92 D 92 >ref|XP_023772597.1| probable mitochondrial adenine nucleotide transporter BTL3 [Lactuca sativa] Length = 424 Score = 60.5 bits (145), Expect = 6e-08 Identities = 34/78 (43%), Positives = 45/78 (57%) Frame = -1 Query: 353 IPKSNPNMSQKLNTTIESPTPSGLFLDNNNTLPHYILKNSTHFSSGHRSCSGGVFRPKDW 174 IP P + + + + GLFLD+N TLPHY++ +TH SS R G+FR K W Sbjct: 13 IPLEAPTSTSGYSISNTNSEGGGLFLDSN-TLPHYLI--NTHHSSTRRRHDIGIFRQKSW 69 Query: 173 ILRNGFCSVSLSGKGSEN 120 + R GF SVSLS KG + Sbjct: 70 VSRGGFLSVSLSVKGGSD 87