BLASTX nr result
ID: Chrysanthemum21_contig00011847
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00011847 (401 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KVE13555.1| hypothetical protein Ccrd_024056 [Cynara carduncu... 80 2e-16 gb|KVI10219.1| hypothetical protein Ccrd_011383 [Cynara carduncu... 58 3e-07 >gb|KVE13555.1| hypothetical protein Ccrd_024056 [Cynara cardunculus var. scolymus] Length = 142 Score = 80.1 bits (196), Expect = 2e-16 Identities = 34/51 (66%), Positives = 41/51 (80%) Frame = +1 Query: 7 LRNSKYQLVYSRFPDFVPWVPTKEKQPKRVRHKATKAKPDSPRYKVGKSFG 159 LRNSK Q +Y+RFPDFVPW+P K KQ K+ +HK K +P SPRYK+GKSFG Sbjct: 68 LRNSKCQPIYTRFPDFVPWIPIKGKQQKKGQHKPAKTEPSSPRYKIGKSFG 118 >gb|KVI10219.1| hypothetical protein Ccrd_011383 [Cynara cardunculus var. scolymus] Length = 395 Score = 58.2 bits (139), Expect = 3e-07 Identities = 31/55 (56%), Positives = 36/55 (65%) Frame = +1 Query: 1 LHLRNSKYQLVYSRFPDFVPWVPTKEKQPKRVRHKATKAKPDSPRYKVGKSFGRF 165 L LR+SKYQ Y+RFPD PW PTK K PK R KAT+ K S R K+ +S G F Sbjct: 318 LQLRHSKYQPFYTRFPDVAPWFPTKVKLPKSDR-KATERKLGSERCKMHESVGNF 371