BLASTX nr result
ID: Chrysanthemum21_contig00011843
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00011843 (767 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PLY73692.1| hypothetical protein LSAT_5X93961 [Lactuca sativa] 55 2e-06 >gb|PLY73692.1| hypothetical protein LSAT_5X93961 [Lactuca sativa] Length = 100 Score = 55.5 bits (132), Expect = 2e-06 Identities = 29/45 (64%), Positives = 32/45 (71%), Gaps = 1/45 (2%) Frame = +2 Query: 635 GRISRNSVDRQRYGYQDKK-EMEKQQCEHYGVGCSNRVALDVAEE 766 GRIS+ VDRQ YG QDK+ + QC HYG G SN VALDVAEE Sbjct: 30 GRISQKRVDRQWYGCQDKEGNGQTTQCAHYGSGSSNHVALDVAEE 74