BLASTX nr result
ID: Chrysanthemum21_contig00011591
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00011591 (518 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KVI10323.1| Acyl-CoA N-acyltransferase [Cynara cardunculus va... 57 2e-06 >gb|KVI10323.1| Acyl-CoA N-acyltransferase [Cynara cardunculus var. scolymus] Length = 459 Score = 57.4 bits (137), Expect = 2e-06 Identities = 29/43 (67%), Positives = 36/43 (83%), Gaps = 2/43 (4%) Frame = -1 Query: 125 VRLAMADNG--SDDTKDQISPSLEIVNNDSSADELAREVEETL 3 VRLAMADNG +DDT DQ SP LEIV N++S D+L+R+V+ETL Sbjct: 25 VRLAMADNGLVNDDTNDQNSPPLEIVKNEASVDDLSRDVQETL 67