BLASTX nr result
ID: Chrysanthemum21_contig00011527
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00011527 (350 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_021976545.1| uncharacterized protein LOC110872085 isoform... 53 9e-06 ref|XP_021976544.1| uncharacterized protein LOC110872085 isoform... 53 9e-06 >ref|XP_021976545.1| uncharacterized protein LOC110872085 isoform X2 [Helianthus annuus] gb|OTG17602.1| hypothetical protein HannXRQ_Chr08g0213981 [Helianthus annuus] Length = 252 Score = 53.1 bits (126), Expect = 9e-06 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = -1 Query: 350 ANKEVVFFVASALITFPTLSVGVFLLNNFC 261 ANKEVVFFVASALITFP LS+G+ LLNN C Sbjct: 222 ANKEVVFFVASALITFPALSLGMILLNNVC 251 >ref|XP_021976544.1| uncharacterized protein LOC110872085 isoform X1 [Helianthus annuus] Length = 256 Score = 53.1 bits (126), Expect = 9e-06 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = -1 Query: 350 ANKEVVFFVASALITFPTLSVGVFLLNNFC 261 ANKEVVFFVASALITFP LS+G+ LLNN C Sbjct: 226 ANKEVVFFVASALITFPALSLGMILLNNVC 255