BLASTX nr result
ID: Chrysanthemum21_contig00010880
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00010880 (442 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_023772569.1| pentatricopeptide repeat-containing protein ... 92 6e-19 ref|XP_022038336.1| pentatricopeptide repeat-containing protein ... 92 1e-18 ref|XP_023546092.1| pentatricopeptide repeat-containing protein ... 88 3e-17 ref|XP_022999638.1| pentatricopeptide repeat-containing protein ... 88 3e-17 ref|XP_022946456.1| pentatricopeptide repeat-containing protein ... 88 3e-17 ref|XP_008464858.1| PREDICTED: pentatricopeptide repeat-containi... 88 3e-17 ref|XP_004144287.1| PREDICTED: pentatricopeptide repeat-containi... 88 3e-17 ref|XP_006473771.1| PREDICTED: pentatricopeptide repeat-containi... 81 3e-17 gb|KDO85079.1| hypothetical protein CISIN_1g0057291mg, partial [... 80 9e-17 ref|XP_023772570.1| pentatricopeptide repeat-containing protein ... 86 9e-17 ref|XP_022153134.1| pentatricopeptide repeat-containing protein ... 86 1e-16 gb|KCW70313.1| hypothetical protein EUGRSUZ_F03554 [Eucalyptus g... 79 5e-16 ref|XP_002272226.1| PREDICTED: pentatricopeptide repeat-containi... 84 6e-16 ref|XP_011041249.1| PREDICTED: pentatricopeptide repeat-containi... 84 6e-16 ref|XP_002306972.1| hypothetical protein POPTR_0005s27160g [Popu... 84 6e-16 emb|CAN83144.1| hypothetical protein VITISV_040783 [Vitis vinifera] 84 6e-16 ref|XP_016706696.1| PREDICTED: pentatricopeptide repeat-containi... 77 7e-16 ref|XP_008789774.1| PREDICTED: pentatricopeptide repeat-containi... 84 8e-16 ref|XP_023730695.1| pentatricopeptide repeat-containing protein ... 84 8e-16 ref|XP_021997674.1| pentatricopeptide repeat-containing protein ... 84 8e-16 >ref|XP_023772569.1| pentatricopeptide repeat-containing protein At5g42310, chloroplastic isoform X1 [Lactuca sativa] gb|PLY78699.1| hypothetical protein LSAT_9X45140 [Lactuca sativa] Length = 696 Score = 92.4 bits (228), Expect = 6e-19 Identities = 45/50 (90%), Positives = 47/50 (94%) Frame = -1 Query: 442 TTLMKALIRVEKFDEVPRVYEEMVKSGCTPDGKARATLRSALRYMRRTLD 293 TTLMKALIRVEKF EVPRVYEEMV GCTPDGKARATLRSALRYMR+TL+ Sbjct: 646 TTLMKALIRVEKFSEVPRVYEEMVSYGCTPDGKARATLRSALRYMRKTLE 695 >ref|XP_022038336.1| pentatricopeptide repeat-containing protein At5g42310, mitochondrial-like isoform X1 [Helianthus annuus] gb|OTG25360.1| putative pentatricopeptide repeat (PPR-like) superfamily protein [Helianthus annuus] Length = 688 Score = 91.7 bits (226), Expect = 1e-18 Identities = 46/50 (92%), Positives = 47/50 (94%) Frame = -1 Query: 442 TTLMKALIRVEKFDEVPRVYEEMVKSGCTPDGKARATLRSALRYMRRTLD 293 TTLMKALIRVEKF EVP VYEEMVKSGCTPD KARATLRSALRYMRRTL+ Sbjct: 638 TTLMKALIRVEKFSEVPCVYEEMVKSGCTPDTKARATLRSALRYMRRTLE 687 >ref|XP_023546092.1| pentatricopeptide repeat-containing protein At5g42310, chloroplastic [Cucurbita pepo subsp. pepo] ref|XP_023546093.1| pentatricopeptide repeat-containing protein At5g42310, chloroplastic [Cucurbita pepo subsp. pepo] Length = 719 Score = 87.8 bits (216), Expect = 3e-17 Identities = 42/49 (85%), Positives = 46/49 (93%) Frame = -1 Query: 442 TTLMKALIRVEKFDEVPRVYEEMVKSGCTPDGKARATLRSALRYMRRTL 296 TTLMKALIRVEKFD+VP VYEEM+ SGCTPDGKARA LRSAL+YM+RTL Sbjct: 669 TTLMKALIRVEKFDKVPAVYEEMILSGCTPDGKARAMLRSALKYMKRTL 717 >ref|XP_022999638.1| pentatricopeptide repeat-containing protein At5g42310, chloroplastic [Cucurbita maxima] Length = 719 Score = 87.8 bits (216), Expect = 3e-17 Identities = 42/49 (85%), Positives = 46/49 (93%) Frame = -1 Query: 442 TTLMKALIRVEKFDEVPRVYEEMVKSGCTPDGKARATLRSALRYMRRTL 296 TTLMKALIRVEKFD+VP VYEEM+ SGCTPDGKARA LRSAL+YM+RTL Sbjct: 669 TTLMKALIRVEKFDKVPAVYEEMILSGCTPDGKARAMLRSALKYMKRTL 717 >ref|XP_022946456.1| pentatricopeptide repeat-containing protein At5g42310, chloroplastic [Cucurbita moschata] Length = 719 Score = 87.8 bits (216), Expect = 3e-17 Identities = 42/49 (85%), Positives = 46/49 (93%) Frame = -1 Query: 442 TTLMKALIRVEKFDEVPRVYEEMVKSGCTPDGKARATLRSALRYMRRTL 296 TTLMKALIRVEKFD+VP VYEEM+ SGCTPDGKARA LRSAL+YM+RTL Sbjct: 669 TTLMKALIRVEKFDKVPAVYEEMILSGCTPDGKARAMLRSALKYMKRTL 717 >ref|XP_008464858.1| PREDICTED: pentatricopeptide repeat-containing protein At5g42310, mitochondrial [Cucumis melo] Length = 720 Score = 87.8 bits (216), Expect = 3e-17 Identities = 42/49 (85%), Positives = 46/49 (93%) Frame = -1 Query: 442 TTLMKALIRVEKFDEVPRVYEEMVKSGCTPDGKARATLRSALRYMRRTL 296 TTLMKALIRV+KFD+VP VYEEM+ SGCTPDGKARA LRSALRYM+RTL Sbjct: 670 TTLMKALIRVDKFDKVPAVYEEMILSGCTPDGKARAMLRSALRYMKRTL 718 >ref|XP_004144287.1| PREDICTED: pentatricopeptide repeat-containing protein At5g42310, mitochondrial [Cucumis sativus] gb|KGN47545.1| hypothetical protein Csa_6G358090 [Cucumis sativus] Length = 720 Score = 87.8 bits (216), Expect = 3e-17 Identities = 42/49 (85%), Positives = 46/49 (93%) Frame = -1 Query: 442 TTLMKALIRVEKFDEVPRVYEEMVKSGCTPDGKARATLRSALRYMRRTL 296 TTLMKALIRV+KFD+VP VYEEM+ SGCTPDGKARA LRSALRYM+RTL Sbjct: 670 TTLMKALIRVDKFDKVPAVYEEMILSGCTPDGKARAMLRSALRYMKRTL 718 >ref|XP_006473771.1| PREDICTED: pentatricopeptide repeat-containing protein At5g42310, mitochondrial-like [Citrus sinensis] ref|XP_006473772.1| PREDICTED: pentatricopeptide repeat-containing protein At5g42310, mitochondrial-like [Citrus sinensis] Length = 99 Score = 81.3 bits (199), Expect = 3e-17 Identities = 39/49 (79%), Positives = 44/49 (89%) Frame = -1 Query: 442 TTLMKALIRVEKFDEVPRVYEEMVKSGCTPDGKARATLRSALRYMRRTL 296 TTLMKALIRV+KF +VP VYEEM+ SGCTPD KARA LRSALRYM++TL Sbjct: 49 TTLMKALIRVDKFHKVPAVYEEMISSGCTPDRKARAMLRSALRYMKQTL 97 >gb|KDO85079.1| hypothetical protein CISIN_1g0057291mg, partial [Citrus sinensis] Length = 111 Score = 80.5 bits (197), Expect = 9e-17 Identities = 39/49 (79%), Positives = 44/49 (89%) Frame = -1 Query: 442 TTLMKALIRVEKFDEVPRVYEEMVKSGCTPDGKARATLRSALRYMRRTL 296 TTLMKALIRV+KF +VP VYEEM+ SGCTPD KARA LRSALRYM++TL Sbjct: 61 TTLMKALIRVDKFHKVPAVYEEMILSGCTPDRKARAMLRSALRYMKQTL 109 >ref|XP_023772570.1| pentatricopeptide repeat-containing protein At5g42310, chloroplastic isoform X2 [Lactuca sativa] Length = 696 Score = 86.3 bits (212), Expect = 9e-17 Identities = 43/49 (87%), Positives = 44/49 (89%) Frame = -1 Query: 442 TTLMKALIRVEKFDEVPRVYEEMVKSGCTPDGKARATLRSALRYMRRTL 296 TTLMKALIRVEKF EVPRVYEEMV GCTPDGKARATLRSALRY+ R L Sbjct: 646 TTLMKALIRVEKFSEVPRVYEEMVSYGCTPDGKARATLRSALRYIYRLL 694 >ref|XP_022153134.1| pentatricopeptide repeat-containing protein At5g42310, mitochondrial isoform X1 [Momordica charantia] Length = 709 Score = 85.9 bits (211), Expect = 1e-16 Identities = 41/49 (83%), Positives = 46/49 (93%) Frame = -1 Query: 442 TTLMKALIRVEKFDEVPRVYEEMVKSGCTPDGKARATLRSALRYMRRTL 296 TTLMKALIRV+KF++VP VYEEM+ SGCTPDGKARA LRSALRYM+RTL Sbjct: 659 TTLMKALIRVDKFNKVPAVYEEMILSGCTPDGKARAMLRSALRYMKRTL 707 >gb|KCW70313.1| hypothetical protein EUGRSUZ_F03554 [Eucalyptus grandis] Length = 111 Score = 78.6 bits (192), Expect = 5e-16 Identities = 38/49 (77%), Positives = 42/49 (85%) Frame = -1 Query: 442 TTLMKALIRVEKFDEVPRVYEEMVKSGCTPDGKARATLRSALRYMRRTL 296 TTLMK LIRV+KF +VP VYEEM+ SGC PD KARA LRSALRYMR+TL Sbjct: 60 TTLMKVLIRVDKFQKVPEVYEEMIVSGCMPDRKARAMLRSALRYMRQTL 108 >ref|XP_002272226.1| PREDICTED: pentatricopeptide repeat-containing protein At5g42310, mitochondrial [Vitis vinifera] emb|CBI40709.3| unnamed protein product, partial [Vitis vinifera] Length = 695 Score = 84.0 bits (206), Expect = 6e-16 Identities = 42/49 (85%), Positives = 43/49 (87%) Frame = -1 Query: 442 TTLMKALIRVEKFDEVPRVYEEMVKSGCTPDGKARATLRSALRYMRRTL 296 TTLMKALIRVEKFD+VP VYEEM SGCTPD KARA LRSALRYM RTL Sbjct: 645 TTLMKALIRVEKFDKVPAVYEEMTLSGCTPDRKARAMLRSALRYMERTL 693 >ref|XP_011041249.1| PREDICTED: pentatricopeptide repeat-containing protein At5g42310, mitochondrial-like [Populus euphratica] Length = 701 Score = 84.0 bits (206), Expect = 6e-16 Identities = 40/50 (80%), Positives = 46/50 (92%) Frame = -1 Query: 442 TTLMKALIRVEKFDEVPRVYEEMVKSGCTPDGKARATLRSALRYMRRTLD 293 TTLMKALIRVEKFD+VP VYEEM+ SGCTPD KARA LRSAL+YM++TL+ Sbjct: 651 TTLMKALIRVEKFDKVPSVYEEMILSGCTPDRKARAMLRSALKYMKQTLE 700 >ref|XP_002306972.1| hypothetical protein POPTR_0005s27160g [Populus trichocarpa] gb|PNT38637.1| hypothetical protein POPTR_005G250200v3 [Populus trichocarpa] Length = 709 Score = 84.0 bits (206), Expect = 6e-16 Identities = 40/50 (80%), Positives = 46/50 (92%) Frame = -1 Query: 442 TTLMKALIRVEKFDEVPRVYEEMVKSGCTPDGKARATLRSALRYMRRTLD 293 TTLMKALIRVEKFD+VP VYEEM+ SGCTPD KARA LRSAL+YM++TL+ Sbjct: 659 TTLMKALIRVEKFDKVPSVYEEMILSGCTPDRKARAMLRSALKYMKQTLE 708 >emb|CAN83144.1| hypothetical protein VITISV_040783 [Vitis vinifera] Length = 724 Score = 84.0 bits (206), Expect = 6e-16 Identities = 42/49 (85%), Positives = 43/49 (87%) Frame = -1 Query: 442 TTLMKALIRVEKFDEVPRVYEEMVKSGCTPDGKARATLRSALRYMRRTL 296 TTLMKALIRVEKFD+VP VYEEM SGCTPD KARA LRSALRYM RTL Sbjct: 674 TTLMKALIRVEKFDKVPAVYEEMTLSGCTPDRKARAMLRSALRYMERTL 722 >ref|XP_016706696.1| PREDICTED: pentatricopeptide repeat-containing protein At5g42310, mitochondrial-like isoform X2 [Gossypium hirsutum] Length = 85 Score = 77.4 bits (189), Expect = 7e-16 Identities = 37/49 (75%), Positives = 43/49 (87%) Frame = -1 Query: 442 TTLMKALIRVEKFDEVPRVYEEMVKSGCTPDGKARATLRSALRYMRRTL 296 TTLMKALIRV+KF +VP VYEEM+ SGCTPD KARA LRSALRYM++ + Sbjct: 26 TTLMKALIRVDKFHKVPAVYEEMILSGCTPDRKARAMLRSALRYMKQAV 74 >ref|XP_008789774.1| PREDICTED: pentatricopeptide repeat-containing protein At5g42310, mitochondrial [Phoenix dactylifera] ref|XP_017698300.1| PREDICTED: pentatricopeptide repeat-containing protein At5g42310, mitochondrial [Phoenix dactylifera] Length = 685 Score = 83.6 bits (205), Expect = 8e-16 Identities = 40/50 (80%), Positives = 45/50 (90%) Frame = -1 Query: 442 TTLMKALIRVEKFDEVPRVYEEMVKSGCTPDGKARATLRSALRYMRRTLD 293 TTLMKALIRVEKF++VP VYEEM+ SGCTPD KARA LRSALRYM++T D Sbjct: 635 TTLMKALIRVEKFEKVPAVYEEMISSGCTPDRKARAMLRSALRYMKQTRD 684 >ref|XP_023730695.1| pentatricopeptide repeat-containing protein At5g42310, chloroplastic-like [Lactuca sativa] gb|PLY76268.1| hypothetical protein LSAT_8X26180 [Lactuca sativa] Length = 688 Score = 83.6 bits (205), Expect = 8e-16 Identities = 41/49 (83%), Positives = 44/49 (89%) Frame = -1 Query: 442 TTLMKALIRVEKFDEVPRVYEEMVKSGCTPDGKARATLRSALRYMRRTL 296 TTLMKALIRVEKFDEVP VYEEM+ SGCTPD KARA LRSAL+YMR+ L Sbjct: 635 TTLMKALIRVEKFDEVPGVYEEMIMSGCTPDRKARAKLRSALKYMRQRL 683 >ref|XP_021997674.1| pentatricopeptide repeat-containing protein At5g42310, mitochondrial-like [Helianthus annuus] gb|OTG04904.1| putative tetratricopeptide-like helical domain-containing protein [Helianthus annuus] Length = 694 Score = 83.6 bits (205), Expect = 8e-16 Identities = 41/49 (83%), Positives = 44/49 (89%) Frame = -1 Query: 442 TTLMKALIRVEKFDEVPRVYEEMVKSGCTPDGKARATLRSALRYMRRTL 296 TTLMKALIRVEKFDEVP VYEEM+ SGCTPD KARA LRSAL+YMR+ L Sbjct: 636 TTLMKALIRVEKFDEVPAVYEEMILSGCTPDRKARAKLRSALKYMRQRL 684