BLASTX nr result
ID: Chrysanthemum21_contig00010656
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00010656 (516 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_023741463.1| thioredoxin-like protein HCF164, chloroplast... 86 9e-18 ref|XP_023730132.1| thioredoxin-like protein HCF164, chloroplast... 87 1e-17 gb|KVI02634.1| Thioredoxin, partial [Cynara cardunculus var. sco... 87 2e-17 gb|PLY67940.1| hypothetical protein LSAT_5X160121 [Lactuca sativa] 86 6e-17 ref|XP_021998612.1| thioredoxin-like protein HCF164, chloroplast... 67 3e-10 >ref|XP_023741463.1| thioredoxin-like protein HCF164, chloroplastic [Lactuca sativa] Length = 168 Score = 85.5 bits (210), Expect = 9e-18 Identities = 42/55 (76%), Positives = 45/55 (81%) Frame = +2 Query: 350 RYHKLYCQTEPNSTDSISEKNVNVESGSDKDNKTGEVTSSPSGGGLPELPNKSLN 514 R+ LYC+TEPN TDS SEKN VESGSDK+ K EVTSSPSGGGLP LPNKSLN Sbjct: 41 RFQWLYCETEPNPTDSNSEKNSIVESGSDKEEKNLEVTSSPSGGGLPALPNKSLN 95 >ref|XP_023730132.1| thioredoxin-like protein HCF164, chloroplastic [Lactuca sativa] gb|PLY76712.1| hypothetical protein LSAT_3X94020 [Lactuca sativa] Length = 261 Score = 87.4 bits (215), Expect = 1e-17 Identities = 41/55 (74%), Positives = 46/55 (83%) Frame = +2 Query: 350 RYHKLYCQTEPNSTDSISEKNVNVESGSDKDNKTGEVTSSPSGGGLPELPNKSLN 514 R+ +LYCQTEPN TDS SEKN VESGSDKD+K EVT SPSGGGLP LPNK++N Sbjct: 41 RFQRLYCQTEPNPTDSNSEKNSIVESGSDKDDKITEVTDSPSGGGLPALPNKTIN 95 >gb|KVI02634.1| Thioredoxin, partial [Cynara cardunculus var. scolymus] Length = 292 Score = 87.0 bits (214), Expect = 2e-17 Identities = 41/55 (74%), Positives = 47/55 (85%) Frame = +2 Query: 350 RYHKLYCQTEPNSTDSISEKNVNVESGSDKDNKTGEVTSSPSGGGLPELPNKSLN 514 RY +LYCQTE NSTDS SEKN+ +ESGS +DNKT EVTSSPSGG LP LPNK++N Sbjct: 72 RYQRLYCQTESNSTDSNSEKNLIIESGSVEDNKTSEVTSSPSGGELPALPNKNIN 126 >gb|PLY67940.1| hypothetical protein LSAT_5X160121 [Lactuca sativa] Length = 270 Score = 85.5 bits (210), Expect = 6e-17 Identities = 42/55 (76%), Positives = 45/55 (81%) Frame = +2 Query: 350 RYHKLYCQTEPNSTDSISEKNVNVESGSDKDNKTGEVTSSPSGGGLPELPNKSLN 514 R+ LYC+TEPN TDS SEKN VESGSDK+ K EVTSSPSGGGLP LPNKSLN Sbjct: 41 RFQWLYCETEPNPTDSNSEKNSIVESGSDKEEKNLEVTSSPSGGGLPALPNKSLN 95 >ref|XP_021998612.1| thioredoxin-like protein HCF164, chloroplastic [Helianthus annuus] gb|OTG05874.1| putative thioredoxin-like protein [Helianthus annuus] Length = 251 Score = 67.4 bits (163), Expect = 3e-10 Identities = 36/55 (65%), Positives = 38/55 (69%) Frame = +2 Query: 350 RYHKLYCQTEPNSTDSISEKNVNVESGSDKDNKTGEVTSSPSGGGLPELPNKSLN 514 RY KLYCQTEPN T+ VESG+D DNK E TSSPSG PELPNKSLN Sbjct: 38 RYQKLYCQTEPNPTEI-------VESGTDVDNKNIEDTSSPSGVPFPELPNKSLN 85