BLASTX nr result
ID: Chrysanthemum21_contig00010277
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00010277 (1370 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_021640149.1| uncharacterized protein LOC110635210, partia... 60 8e-07 ref|XP_017249709.1| PREDICTED: E3 ubiquitin-protein ligase MARCH... 57 4e-06 ref|XP_008352985.1| PREDICTED: E3 ubiquitin-protein ligase MARCH... 57 4e-06 ref|XP_010046895.1| PREDICTED: E3 ubiquitin-protein ligase MARCH... 56 5e-06 ref|XP_011075501.1| uncharacterized protein LOC105159964 [Sesamu... 59 5e-06 gb|KRH62902.1| hypothetical protein GLYMA_04G141200 [Glycine max] 58 5e-06 gb|EPS60115.1| hypothetical protein M569_14689, partial [Genlise... 57 6e-06 ref|XP_014630601.1| PREDICTED: E3 ubiquitin-protein ligase MARCH... 56 6e-06 emb|CDY21459.1| BnaC03g27380D [Brassica napus] 54 7e-06 ref|XP_018503827.1| PREDICTED: uncharacterized protein LOC103950... 59 9e-06 ref|XP_017192652.1| PREDICTED: uncharacterized protein LOC103451... 59 9e-06 ref|XP_018503826.1| PREDICTED: uncharacterized protein LOC103950... 59 9e-06 ref|XP_017192651.1| PREDICTED: uncharacterized protein LOC103451... 59 9e-06 >ref|XP_021640149.1| uncharacterized protein LOC110635210, partial [Hevea brasiliensis] Length = 207 Score = 60.5 bits (145), Expect = 8e-07 Identities = 24/37 (64%), Positives = 28/37 (75%) Frame = -1 Query: 362 FFEEYVHRKCVQYWCNEKGDMSCEICHHVL*AYSDGY 252 FF +Y HRKCVQ+WCNEKGD++CEICH Y GY Sbjct: 9 FFIQYAHRKCVQHWCNEKGDITCEICHQ---PYQPGY 42 >ref|XP_017249709.1| PREDICTED: E3 ubiquitin-protein ligase MARCH2-like [Daucus carota subsp. sativus] ref|XP_017249710.1| PREDICTED: E3 ubiquitin-protein ligase MARCH2-like [Daucus carota subsp. sativus] Length = 128 Score = 56.6 bits (135), Expect = 4e-06 Identities = 20/26 (76%), Positives = 24/26 (92%) Frame = -1 Query: 353 EYVHRKCVQYWCNEKGDMSCEICHHV 276 +Y HRKCVQ+WCNEKGD++CEICH V Sbjct: 91 KYAHRKCVQHWCNEKGDINCEICHQV 116 >ref|XP_008352985.1| PREDICTED: E3 ubiquitin-protein ligase MARCH9-like [Malus domestica] Length = 133 Score = 56.6 bits (135), Expect = 4e-06 Identities = 22/34 (64%), Positives = 26/34 (76%) Frame = -1 Query: 353 EYVHRKCVQYWCNEKGDMSCEICHHVL*AYSDGY 252 +Y HRKCVQ+WCNEKGD++CEICH Y GY Sbjct: 87 KYAHRKCVQHWCNEKGDITCEICHQ---PYQPGY 117 >ref|XP_010046895.1| PREDICTED: E3 ubiquitin-protein ligase MARCH11 [Eucalyptus grandis] Length = 124 Score = 56.2 bits (134), Expect = 5e-06 Identities = 19/26 (73%), Positives = 24/26 (92%) Frame = -1 Query: 353 EYVHRKCVQYWCNEKGDMSCEICHHV 276 +Y HRKC+Q+WCNEKGD++CEICH V Sbjct: 99 KYAHRKCIQHWCNEKGDITCEICHQV 124 >ref|XP_011075501.1| uncharacterized protein LOC105159964 [Sesamum indicum] ref|XP_011075502.1| uncharacterized protein LOC105159964 [Sesamum indicum] Length = 286 Score = 59.3 bits (142), Expect = 5e-06 Identities = 23/34 (67%), Positives = 27/34 (79%) Frame = -1 Query: 353 EYVHRKCVQYWCNEKGDMSCEICHHVL*AYSDGY 252 +Y HRKCVQYWCNEKGD++CEICH +Y GY Sbjct: 97 KYAHRKCVQYWCNEKGDITCEICHQ---SYQPGY 127 >gb|KRH62902.1| hypothetical protein GLYMA_04G141200 [Glycine max] Length = 194 Score = 57.8 bits (138), Expect = 5e-06 Identities = 20/26 (76%), Positives = 25/26 (96%) Frame = -1 Query: 353 EYVHRKCVQYWCNEKGDMSCEICHHV 276 +Y HRKCVQ+WC+EKGD++CEICHHV Sbjct: 94 KYAHRKCVQHWCDEKGDITCEICHHV 119 >gb|EPS60115.1| hypothetical protein M569_14689, partial [Genlisea aurea] Length = 163 Score = 57.0 bits (136), Expect = 6e-06 Identities = 22/36 (61%), Positives = 27/36 (75%) Frame = -1 Query: 353 EYVHRKCVQYWCNEKGDMSCEICHHVL*AYSDGYDS 246 +Y HRKCVQ+WCNEKGD++CEICH Y GY + Sbjct: 34 KYAHRKCVQHWCNEKGDITCEICHQ---PYQPGYSA 66 >ref|XP_014630601.1| PREDICTED: E3 ubiquitin-protein ligase MARCH9-like [Glycine max] Length = 139 Score = 56.2 bits (134), Expect = 6e-06 Identities = 19/25 (76%), Positives = 24/25 (96%) Frame = -1 Query: 353 EYVHRKCVQYWCNEKGDMSCEICHH 279 +Y HRKCVQ+WC+EKGD++CEICHH Sbjct: 94 KYAHRKCVQHWCDEKGDITCEICHH 118 >emb|CDY21459.1| BnaC03g27380D [Brassica napus] Length = 66 Score = 53.9 bits (128), Expect = 7e-06 Identities = 20/27 (74%), Positives = 22/27 (81%) Frame = -1 Query: 353 EYVHRKCVQYWCNEKGDMSCEICHHVL 273 +Y HRKCVQ WCNEKGD +CEICH L Sbjct: 34 KYAHRKCVQRWCNEKGDTTCEICHQFL 60 >ref|XP_018503827.1| PREDICTED: uncharacterized protein LOC103950823 isoform X2 [Pyrus x bretschneideri] Length = 291 Score = 58.5 bits (140), Expect = 9e-06 Identities = 23/34 (67%), Positives = 26/34 (76%) Frame = -1 Query: 353 EYVHRKCVQYWCNEKGDMSCEICHHVL*AYSDGY 252 +Y HRKCVQYWCNEKGD++CEICH Y GY Sbjct: 89 KYAHRKCVQYWCNEKGDITCEICHQ---PYQPGY 119 >ref|XP_017192652.1| PREDICTED: uncharacterized protein LOC103451817 isoform X2 [Malus domestica] Length = 291 Score = 58.5 bits (140), Expect = 9e-06 Identities = 23/34 (67%), Positives = 26/34 (76%) Frame = -1 Query: 353 EYVHRKCVQYWCNEKGDMSCEICHHVL*AYSDGY 252 +Y HRKCVQYWCNEKGD++CEICH Y GY Sbjct: 89 KYAHRKCVQYWCNEKGDITCEICHQ---PYQPGY 119 >ref|XP_018503826.1| PREDICTED: uncharacterized protein LOC103950823 isoform X1 [Pyrus x bretschneideri] Length = 298 Score = 58.5 bits (140), Expect = 9e-06 Identities = 23/34 (67%), Positives = 26/34 (76%) Frame = -1 Query: 353 EYVHRKCVQYWCNEKGDMSCEICHHVL*AYSDGY 252 +Y HRKCVQYWCNEKGD++CEICH Y GY Sbjct: 89 KYAHRKCVQYWCNEKGDITCEICHQ---PYQPGY 119 >ref|XP_017192651.1| PREDICTED: uncharacterized protein LOC103451817 isoform X1 [Malus domestica] Length = 298 Score = 58.5 bits (140), Expect = 9e-06 Identities = 23/34 (67%), Positives = 26/34 (76%) Frame = -1 Query: 353 EYVHRKCVQYWCNEKGDMSCEICHHVL*AYSDGY 252 +Y HRKCVQYWCNEKGD++CEICH Y GY Sbjct: 89 KYAHRKCVQYWCNEKGDITCEICHQ---PYQPGY 119