BLASTX nr result
ID: Chrysanthemum21_contig00010252
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00010252 (383 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_021998950.1| zinc finger CCCH domain-containing protein 5... 54 7e-06 gb|OTG06161.1| putative RNA recognition motif domain, eukaryote ... 54 7e-06 >ref|XP_021998950.1| zinc finger CCCH domain-containing protein 5 [Helianthus annuus] ref|XP_021998951.1| zinc finger CCCH domain-containing protein 5 [Helianthus annuus] Length = 648 Score = 54.3 bits (129), Expect = 7e-06 Identities = 28/73 (38%), Positives = 39/73 (53%) Frame = +3 Query: 30 HDEGVNDHRESEDERYANKQKRHKRKSATDKNNTNDRWEPDSSPIEHGNDYELSDVRKSN 209 HD+ V + + +Q R + + DKN+ +DRW+P IEH DYE+SD RK Sbjct: 554 HDDRVEVDYQESKKAEGRRQHRPRSHESADKNDASDRWQPH---IEHDYDYEISDGRKPK 610 Query: 210 DKRSSREIGSGSV 248 D+ E SGSV Sbjct: 611 DRIIDHETPSGSV 623 >gb|OTG06161.1| putative RNA recognition motif domain, eukaryote [Helianthus annuus] Length = 708 Score = 54.3 bits (129), Expect = 7e-06 Identities = 28/73 (38%), Positives = 39/73 (53%) Frame = +3 Query: 30 HDEGVNDHRESEDERYANKQKRHKRKSATDKNNTNDRWEPDSSPIEHGNDYELSDVRKSN 209 HD+ V + + +Q R + + DKN+ +DRW+P IEH DYE+SD RK Sbjct: 614 HDDRVEVDYQESKKAEGRRQHRPRSHESADKNDASDRWQPH---IEHDYDYEISDGRKPK 670 Query: 210 DKRSSREIGSGSV 248 D+ E SGSV Sbjct: 671 DRIIDHETPSGSV 683