BLASTX nr result
ID: Chrysanthemum21_contig00010048
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00010048 (601 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_021977211.1| RING finger and transmembrane domain-contain... 98 3e-20 ref|XP_023770982.1| E3 ubiquitin-protein ligase RNFT1-like [Lact... 98 3e-20 gb|KVI07081.1| hypothetical protein Ccrd_014569 [Cynara carduncu... 96 9e-20 ref|XP_022013261.1| RING finger and transmembrane domain-contain... 96 1e-19 ref|XP_022013260.1| RING finger and transmembrane domain-contain... 96 1e-19 ref|XP_023743956.1| E3 ubiquitin-protein ligase RNFT1-like [Lact... 96 2e-19 gb|KVI10047.1| Zinc finger, RING/FYVE/PHD-type [Cynara carduncul... 96 2e-19 ref|XP_009764277.1| PREDICTED: uncharacterized protein LOC104216... 93 2e-19 ref|XP_023737381.1| E3 ubiquitin-protein ligase RNFT1-like [Lact... 95 3e-19 ref|XP_022038078.1| RING finger and transmembrane domain-contain... 95 3e-19 ref|XP_022006561.1| RING finger and transmembrane domain-contain... 94 5e-19 ref|XP_009625552.1| PREDICTED: RING finger and transmembrane dom... 93 8e-19 ref|XP_009625551.1| PREDICTED: RING finger and transmembrane dom... 93 1e-18 ref|XP_017249748.1| PREDICTED: RING finger and transmembrane dom... 92 3e-18 ref|XP_021974096.1| RING finger and transmembrane domain-contain... 92 4e-18 ref|XP_021982066.1| RING finger and transmembrane domain-contain... 92 4e-18 gb|KZM94807.1| hypothetical protein DCAR_018049 [Daucus carota s... 92 4e-18 ref|XP_009781127.1| PREDICTED: RING finger and transmembrane dom... 91 5e-18 ref|XP_021974095.1| RING finger and transmembrane domain-contain... 92 5e-18 ref|XP_017243763.1| PREDICTED: RING finger and transmembrane dom... 91 6e-18 >ref|XP_021977211.1| RING finger and transmembrane domain-containing protein 1-like [Helianthus annuus] gb|OTG18311.1| putative RING/U-box superfamily protein [Helianthus annuus] Length = 456 Score = 97.8 bits (242), Expect = 3e-20 Identities = 47/54 (87%), Positives = 51/54 (94%) Frame = +3 Query: 438 IRQHLQGFFVTIYVSAFMYKSNDILRKQTALKGERKFSVLAGYYIVFVLQVIGV 599 IRQHLQGFFVTIYV+AFMYKSNDIL+KQTALKGERK SVL GY++VFVL VIGV Sbjct: 189 IRQHLQGFFVTIYVTAFMYKSNDILQKQTALKGERKLSVLGGYFVVFVLHVIGV 242 >ref|XP_023770982.1| E3 ubiquitin-protein ligase RNFT1-like [Lactuca sativa] gb|PLY79875.1| hypothetical protein LSAT_8X11301 [Lactuca sativa] Length = 462 Score = 97.8 bits (242), Expect = 3e-20 Identities = 46/54 (85%), Positives = 51/54 (94%) Frame = +3 Query: 438 IRQHLQGFFVTIYVSAFMYKSNDILRKQTALKGERKFSVLAGYYIVFVLQVIGV 599 IRQHLQGFFVT+YV+AFMYKSNDILRKQTALKGER+ SVL GY+IVF+L VIGV Sbjct: 195 IRQHLQGFFVTVYVTAFMYKSNDILRKQTALKGERRLSVLGGYFIVFILHVIGV 248 >gb|KVI07081.1| hypothetical protein Ccrd_014569 [Cynara cardunculus var. scolymus] Length = 446 Score = 96.3 bits (238), Expect = 9e-20 Identities = 47/54 (87%), Positives = 50/54 (92%) Frame = +3 Query: 438 IRQHLQGFFVTIYVSAFMYKSNDILRKQTALKGERKFSVLAGYYIVFVLQVIGV 599 IRQHLQGFFVTIYV+AFMYKSNDILRKQTALKGERK SVL GY I+F+L VIGV Sbjct: 190 IRQHLQGFFVTIYVTAFMYKSNDILRKQTALKGERKLSVLVGYSIIFMLHVIGV 243 >ref|XP_022013261.1| RING finger and transmembrane domain-containing protein 1-like isoform X2 [Helianthus annuus] gb|OTF96390.1| putative zinc finger, RING/FYVE/PHD-type [Helianthus annuus] Length = 447 Score = 95.9 bits (237), Expect = 1e-19 Identities = 46/54 (85%), Positives = 50/54 (92%) Frame = +3 Query: 438 IRQHLQGFFVTIYVSAFMYKSNDILRKQTALKGERKFSVLAGYYIVFVLQVIGV 599 IRQHLQGFFVTIYV+AFMYKSNDILRKQTALKGERK SVL GY I+F+L V+GV Sbjct: 180 IRQHLQGFFVTIYVTAFMYKSNDILRKQTALKGERKLSVLVGYSIIFMLHVVGV 233 >ref|XP_022013260.1| RING finger and transmembrane domain-containing protein 1-like isoform X1 [Helianthus annuus] Length = 448 Score = 95.9 bits (237), Expect = 1e-19 Identities = 46/54 (85%), Positives = 50/54 (92%) Frame = +3 Query: 438 IRQHLQGFFVTIYVSAFMYKSNDILRKQTALKGERKFSVLAGYYIVFVLQVIGV 599 IRQHLQGFFVTIYV+AFMYKSNDILRKQTALKGERK SVL GY I+F+L V+GV Sbjct: 180 IRQHLQGFFVTIYVTAFMYKSNDILRKQTALKGERKLSVLVGYSIIFMLHVVGV 233 >ref|XP_023743956.1| E3 ubiquitin-protein ligase RNFT1-like [Lactuca sativa] gb|PLY66083.1| hypothetical protein LSAT_2X127400 [Lactuca sativa] Length = 465 Score = 95.5 bits (236), Expect = 2e-19 Identities = 47/54 (87%), Positives = 50/54 (92%) Frame = +3 Query: 438 IRQHLQGFFVTIYVSAFMYKSNDILRKQTALKGERKFSVLAGYYIVFVLQVIGV 599 IRQHLQG FVTIY++AFMYKSNDILRKQTALKGERK SVLAGY IVF+L VIGV Sbjct: 198 IRQHLQGLFVTIYITAFMYKSNDILRKQTALKGERKLSVLAGYCIVFMLHVIGV 251 >gb|KVI10047.1| Zinc finger, RING/FYVE/PHD-type [Cynara cardunculus var. scolymus] Length = 470 Score = 95.5 bits (236), Expect = 2e-19 Identities = 47/54 (87%), Positives = 50/54 (92%) Frame = +3 Query: 438 IRQHLQGFFVTIYVSAFMYKSNDILRKQTALKGERKFSVLAGYYIVFVLQVIGV 599 IRQHLQG FVTIY++AFMYKSNDILRKQTALKGERK SVLAGY IVF+L VIGV Sbjct: 203 IRQHLQGLFVTIYITAFMYKSNDILRKQTALKGERKLSVLAGYCIVFMLHVIGV 256 >ref|XP_009764277.1| PREDICTED: uncharacterized protein LOC104216014 [Nicotiana sylvestris] Length = 267 Score = 92.8 bits (229), Expect = 2e-19 Identities = 42/54 (77%), Positives = 50/54 (92%) Frame = +3 Query: 438 IRQHLQGFFVTIYVSAFMYKSNDILRKQTALKGERKFSVLAGYYIVFVLQVIGV 599 IRQHLQGFFVTI+++AFM+KSNDILRKQTALKGERK VL GY++VFV+ VIG+ Sbjct: 157 IRQHLQGFFVTIWITAFMFKSNDILRKQTALKGERKIDVLVGYFVVFVIHVIGI 210 >ref|XP_023737381.1| E3 ubiquitin-protein ligase RNFT1-like [Lactuca sativa] gb|PLY71011.1| hypothetical protein LSAT_9X60380 [Lactuca sativa] Length = 466 Score = 95.1 bits (235), Expect = 3e-19 Identities = 47/54 (87%), Positives = 49/54 (90%) Frame = +3 Query: 438 IRQHLQGFFVTIYVSAFMYKSNDILRKQTALKGERKFSVLAGYYIVFVLQVIGV 599 IRQHLQGFFVTIYV+AFMYKSNDILRKQTALKGERK SVL GY I+F L VIGV Sbjct: 199 IRQHLQGFFVTIYVTAFMYKSNDILRKQTALKGERKLSVLIGYGIIFTLHVIGV 252 >ref|XP_022038078.1| RING finger and transmembrane domain-containing protein 1-like [Helianthus annuus] gb|OTG25126.1| putative zinc finger, RING/FYVE/PHD-type [Helianthus annuus] Length = 417 Score = 94.7 bits (234), Expect = 3e-19 Identities = 45/54 (83%), Positives = 51/54 (94%) Frame = +3 Query: 438 IRQHLQGFFVTIYVSAFMYKSNDILRKQTALKGERKFSVLAGYYIVFVLQVIGV 599 IRQHLQGFFVTIYV AF++KSNDIL+KQTALKGER+ SVLAGY++VF LQVIGV Sbjct: 150 IRQHLQGFFVTIYVIAFLFKSNDILQKQTALKGERRLSVLAGYFVVFALQVIGV 203 >ref|XP_022006561.1| RING finger and transmembrane domain-containing protein 1-like [Helianthus annuus] gb|OTF99841.1| putative zinc finger, RING/FYVE/PHD-type [Helianthus annuus] Length = 453 Score = 94.4 bits (233), Expect = 5e-19 Identities = 45/54 (83%), Positives = 50/54 (92%) Frame = +3 Query: 438 IRQHLQGFFVTIYVSAFMYKSNDILRKQTALKGERKFSVLAGYYIVFVLQVIGV 599 IRQHLQG FVTIY++ FMYKSNDILRKQTALKGERK SVLAGY ++F+LQVIGV Sbjct: 186 IRQHLQGIFVTIYIATFMYKSNDILRKQTALKGERKLSVLAGYCVLFMLQVIGV 239 >ref|XP_009625552.1| PREDICTED: RING finger and transmembrane domain-containing protein 1-like isoform X2 [Nicotiana tomentosiformis] Length = 357 Score = 92.8 bits (229), Expect = 8e-19 Identities = 42/54 (77%), Positives = 50/54 (92%) Frame = +3 Query: 438 IRQHLQGFFVTIYVSAFMYKSNDILRKQTALKGERKFSVLAGYYIVFVLQVIGV 599 IRQHLQGFFVTI+++AFM+KSNDILRKQTALKGERK VL GY++VFV+ VIG+ Sbjct: 158 IRQHLQGFFVTIWITAFMFKSNDILRKQTALKGERKIDVLVGYFVVFVIHVIGI 211 >ref|XP_009625551.1| PREDICTED: RING finger and transmembrane domain-containing protein 2-like isoform X1 [Nicotiana tomentosiformis] ref|XP_016509594.1| PREDICTED: RING finger and transmembrane domain-containing protein 2-like [Nicotiana tabacum] Length = 425 Score = 92.8 bits (229), Expect = 1e-18 Identities = 42/54 (77%), Positives = 50/54 (92%) Frame = +3 Query: 438 IRQHLQGFFVTIYVSAFMYKSNDILRKQTALKGERKFSVLAGYYIVFVLQVIGV 599 IRQHLQGFFVTI+++AFM+KSNDILRKQTALKGERK VL GY++VFV+ VIG+ Sbjct: 158 IRQHLQGFFVTIWITAFMFKSNDILRKQTALKGERKIDVLVGYFVVFVIHVIGI 211 >ref|XP_017249748.1| PREDICTED: RING finger and transmembrane domain-containing protein 1-like [Daucus carota subsp. sativus] Length = 462 Score = 92.0 bits (227), Expect = 3e-18 Identities = 42/54 (77%), Positives = 50/54 (92%) Frame = +3 Query: 438 IRQHLQGFFVTIYVSAFMYKSNDILRKQTALKGERKFSVLAGYYIVFVLQVIGV 599 IRQHLQGFFVTIY++AFM+KSNDIL++QT LKGERK SVL GY++VFVL VIG+ Sbjct: 195 IRQHLQGFFVTIYITAFMFKSNDILKRQTVLKGERKLSVLVGYFLVFVLHVIGL 248 >ref|XP_021974096.1| RING finger and transmembrane domain-containing protein 1-like isoform X2 [Helianthus annuus] Length = 417 Score = 91.7 bits (226), Expect = 4e-18 Identities = 43/54 (79%), Positives = 49/54 (90%) Frame = +3 Query: 438 IRQHLQGFFVTIYVSAFMYKSNDILRKQTALKGERKFSVLAGYYIVFVLQVIGV 599 +RQHLQG FVT+Y++AFMYKSNDILRKQTALKGERK SVL GY IVF++ VIGV Sbjct: 218 VRQHLQGIFVTLYITAFMYKSNDILRKQTALKGERKLSVLVGYCIVFMVHVIGV 271 >ref|XP_021982066.1| RING finger and transmembrane domain-containing protein 1-like [Helianthus annuus] gb|OTG14705.1| putative RING finger and transmembrane domain-containing protein 1 [Helianthus annuus] Length = 444 Score = 91.7 bits (226), Expect = 4e-18 Identities = 43/54 (79%), Positives = 49/54 (90%) Frame = +3 Query: 438 IRQHLQGFFVTIYVSAFMYKSNDILRKQTALKGERKFSVLAGYYIVFVLQVIGV 599 IRQHLQGFFVTIYV+AFMYKSNDILRKQTALKGER+ SVL GY ++F+ V+GV Sbjct: 177 IRQHLQGFFVTIYVTAFMYKSNDILRKQTALKGERRLSVLIGYSMIFMFHVVGV 230 >gb|KZM94807.1| hypothetical protein DCAR_018049 [Daucus carota subsp. sativus] Length = 697 Score = 92.0 bits (227), Expect = 4e-18 Identities = 42/54 (77%), Positives = 50/54 (92%) Frame = +3 Query: 438 IRQHLQGFFVTIYVSAFMYKSNDILRKQTALKGERKFSVLAGYYIVFVLQVIGV 599 IRQHLQGFFVTIY++AFM+KSNDIL++QT LKGERK SVL GY++VFVL VIG+ Sbjct: 162 IRQHLQGFFVTIYITAFMFKSNDILKRQTVLKGERKLSVLVGYFLVFVLHVIGL 215 >ref|XP_009781127.1| PREDICTED: RING finger and transmembrane domain-containing protein 1-like isoform X2 [Nicotiana sylvestris] Length = 371 Score = 90.9 bits (224), Expect = 5e-18 Identities = 41/54 (75%), Positives = 51/54 (94%) Frame = +3 Query: 438 IRQHLQGFFVTIYVSAFMYKSNDILRKQTALKGERKFSVLAGYYIVFVLQVIGV 599 IRQHLQGFFVTI+++AFM+KSNDILRKQTALKGERK +VL GY++V++L VIG+ Sbjct: 156 IRQHLQGFFVTIWITAFMFKSNDILRKQTALKGERKITVLLGYFLVYMLHVIGI 209 >ref|XP_021974095.1| RING finger and transmembrane domain-containing protein 1-like isoform X1 [Helianthus annuus] gb|OTG21493.1| putative zinc finger, RING/FYVE/PHD-type [Helianthus annuus] Length = 485 Score = 91.7 bits (226), Expect = 5e-18 Identities = 43/54 (79%), Positives = 49/54 (90%) Frame = +3 Query: 438 IRQHLQGFFVTIYVSAFMYKSNDILRKQTALKGERKFSVLAGYYIVFVLQVIGV 599 +RQHLQG FVT+Y++AFMYKSNDILRKQTALKGERK SVL GY IVF++ VIGV Sbjct: 218 VRQHLQGIFVTLYITAFMYKSNDILRKQTALKGERKLSVLVGYCIVFMVHVIGV 271 >ref|XP_017243763.1| PREDICTED: RING finger and transmembrane domain-containing protein 1-like [Daucus carota subsp. sativus] gb|KZM97981.1| hypothetical protein DCAR_014657 [Daucus carota subsp. sativus] Length = 449 Score = 91.3 bits (225), Expect = 6e-18 Identities = 41/54 (75%), Positives = 50/54 (92%) Frame = +3 Query: 438 IRQHLQGFFVTIYVSAFMYKSNDILRKQTALKGERKFSVLAGYYIVFVLQVIGV 599 IRQHLQGFFVTIY++AF++KSNDIL+KQTALKGERK +VL GY++VF L VIG+ Sbjct: 182 IRQHLQGFFVTIYITAFLFKSNDILKKQTALKGERKLAVLMGYFLVFTLHVIGI 235