BLASTX nr result
ID: Chrysanthemum21_contig00010037
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00010037 (435 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_022015879.1| protein FREE1-like [Helianthus annuus] >gi|1... 60 1e-07 gb|KVI02916.1| hypothetical protein Ccrd_018793, partial [Cynara... 59 3e-07 >ref|XP_022015879.1| protein FREE1-like [Helianthus annuus] gb|OTF93310.1| putative zinc finger, FYVE/PHD-type, Zinc finger, RING/FYVE/PHD-type [Helianthus annuus] Length = 460 Score = 59.7 bits (143), Expect = 1e-07 Identities = 27/31 (87%), Positives = 31/31 (100%) Frame = +3 Query: 39 AEVTQRMSHVNEVAGRASGYNRHEELAKKLQ 131 AEVTQR+SHVNEVAGR+SG+NRHE+LAKKLQ Sbjct: 370 AEVTQRLSHVNEVAGRSSGFNRHEDLAKKLQ 400 >gb|KVI02916.1| hypothetical protein Ccrd_018793, partial [Cynara cardunculus var. scolymus] Length = 595 Score = 58.9 bits (141), Expect = 3e-07 Identities = 27/31 (87%), Positives = 30/31 (96%) Frame = +3 Query: 39 AEVTQRMSHVNEVAGRASGYNRHEELAKKLQ 131 AEVTQR+SHVNEVAGR SG+NRHE+LAKKLQ Sbjct: 431 AEVTQRLSHVNEVAGRPSGFNRHEDLAKKLQ 461