BLASTX nr result
ID: Chrysanthemum21_contig00009992
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00009992 (439 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_022714692.1| enhancer of polycomb-like protein 1 isoform ... 69 1e-10 gb|OMO83299.1| hypothetical protein CCACVL1_11448 [Corchorus cap... 69 1e-10 ref|XP_022723622.1| uncharacterized protein LOC111280463 isoform... 68 2e-10 gb|PPR89131.1| hypothetical protein GOBAR_AA31551 [Gossypium bar... 68 2e-10 ref|XP_020404060.1| uncharacterized protein LOC103647333 isoform... 67 4e-10 ref|XP_008670100.1| uncharacterized protein LOC103647333 isoform... 67 4e-10 gb|EPS74424.1| hypothetical protein M569_00331, partial [Genlise... 67 5e-10 gb|ONM54009.1| Enhancer of polycomb-like transcription factor pr... 65 7e-10 emb|CAN82281.1| hypothetical protein VITISV_029783 [Vitis vinifera] 65 9e-10 gb|KOM56125.1| hypothetical protein LR48_Vigan10g201700 [Vigna a... 65 1e-09 dbj|BAJ86813.1| predicted protein, partial [Hordeum vulgare subs... 65 1e-09 ref|XP_013651034.1| uncharacterized protein LOC106355673 [Brassi... 65 1e-09 gb|PKI72591.1| hypothetical protein CRG98_006968 [Punica granatum] 65 1e-09 gb|KYP40746.1| hypothetical protein KK1_037924, partial [Cajanus... 65 1e-09 ref|XP_019153670.1| PREDICTED: uncharacterized protein LOC109150... 65 1e-09 gb|KDO46865.1| hypothetical protein CISIN_1g0206552mg [Citrus si... 65 1e-09 gb|ESR55175.1| hypothetical protein CICLE_v10021199mg [Citrus cl... 65 1e-09 gb|KDO46864.1| hypothetical protein CISIN_1g0206552mg [Citrus si... 65 1e-09 gb|KRH18236.1| hypothetical protein GLYMA_13G045600 [Glycine max] 65 2e-09 ref|XP_010247400.2| PREDICTED: enhancer of polycomb-like protein... 65 2e-09 >ref|XP_022714692.1| enhancer of polycomb-like protein 1 isoform X3 [Durio zibethinus] Length = 440 Score = 68.6 bits (166), Expect = 1e-10 Identities = 30/45 (66%), Positives = 35/45 (77%) Frame = +3 Query: 282 IRFGGFKDVQTSRPKCPPPPVNDTNPYNVFRPREKAHRLHTRRAE 416 I++G F+ V + PPPPVND NPYNVFRPREKAHRLHTRR + Sbjct: 178 IKYGVFQSVYNYWKEKPPPPVNDNNPYNVFRPREKAHRLHTRRMQ 222 >gb|OMO83299.1| hypothetical protein CCACVL1_11448 [Corchorus capsularis] Length = 440 Score = 68.6 bits (166), Expect = 1e-10 Identities = 30/45 (66%), Positives = 35/45 (77%) Frame = +3 Query: 282 IRFGGFKDVQTSRPKCPPPPVNDTNPYNVFRPREKAHRLHTRRAE 416 I++G F+ V + PPPPVND NPYNVFRPREKAHRLHTRR + Sbjct: 178 IKYGVFQSVYNYWKEKPPPPVNDNNPYNVFRPREKAHRLHTRRMQ 222 >ref|XP_022723622.1| uncharacterized protein LOC111280463 isoform X2 [Durio zibethinus] Length = 439 Score = 67.8 bits (164), Expect = 2e-10 Identities = 29/45 (64%), Positives = 35/45 (77%) Frame = +3 Query: 282 IRFGGFKDVQTSRPKCPPPPVNDTNPYNVFRPREKAHRLHTRRAE 416 I++G F+ + + PPPPVND NPYNVFRPREKAHRLHTRR + Sbjct: 177 IKYGVFQSIYDYWKEKPPPPVNDNNPYNVFRPREKAHRLHTRRMQ 221 >gb|PPR89131.1| hypothetical protein GOBAR_AA31551 [Gossypium barbadense] Length = 440 Score = 67.8 bits (164), Expect = 2e-10 Identities = 30/45 (66%), Positives = 35/45 (77%) Frame = +3 Query: 282 IRFGGFKDVQTSRPKCPPPPVNDTNPYNVFRPREKAHRLHTRRAE 416 I++G F+ V + PPPPVND NPYNVFRPREKAHRLHTRR + Sbjct: 178 IKYGVFQAVYNYWKEKPPPPVNDNNPYNVFRPREKAHRLHTRRMQ 222 >ref|XP_020404060.1| uncharacterized protein LOC103647333 isoform X4 [Zea mays] Length = 452 Score = 67.0 bits (162), Expect = 4e-10 Identities = 30/45 (66%), Positives = 34/45 (75%) Frame = +3 Query: 282 IRFGGFKDVQTSRPKCPPPPVNDTNPYNVFRPREKAHRLHTRRAE 416 +R+ F+ V PPPPVNDTNPYNVFRPREKAHRLHTRR + Sbjct: 187 VRYAIFQAVYNYWKTKPPPPVNDTNPYNVFRPREKAHRLHTRRMQ 231 >ref|XP_008670100.1| uncharacterized protein LOC103647333 isoform X3 [Zea mays] gb|ONM21382.1| Enhancer of polycomb-like transcription factor protein [Zea mays] Length = 455 Score = 67.0 bits (162), Expect = 4e-10 Identities = 30/45 (66%), Positives = 34/45 (75%) Frame = +3 Query: 282 IRFGGFKDVQTSRPKCPPPPVNDTNPYNVFRPREKAHRLHTRRAE 416 +R+ F+ V PPPPVNDTNPYNVFRPREKAHRLHTRR + Sbjct: 190 VRYAIFQAVYNYWKTKPPPPVNDTNPYNVFRPREKAHRLHTRRMQ 234 >gb|EPS74424.1| hypothetical protein M569_00331, partial [Genlisea aurea] Length = 346 Score = 66.6 bits (161), Expect = 5e-10 Identities = 29/35 (82%), Positives = 30/35 (85%) Frame = +3 Query: 330 PPPPVNDTNPYNVFRPREKAHRLHTRRAESLVKAQ 434 PPPPVNDTNPYNVFRPREKAHRLHTRR +L Q Sbjct: 201 PPPPVNDTNPYNVFRPREKAHRLHTRRVMNLALMQ 235 >gb|ONM54009.1| Enhancer of polycomb-like transcription factor protein [Zea mays] Length = 253 Score = 65.5 bits (158), Expect = 7e-10 Identities = 28/31 (90%), Positives = 28/31 (90%) Frame = +3 Query: 330 PPPPVNDTNPYNVFRPREKAHRLHTRRAESL 422 PPPPVNDTNPYNVFRPREKAHRLHTRR L Sbjct: 219 PPPPVNDTNPYNVFRPREKAHRLHTRRVGGL 249 >emb|CAN82281.1| hypothetical protein VITISV_029783 [Vitis vinifera] Length = 253 Score = 65.1 bits (157), Expect = 9e-10 Identities = 27/29 (93%), Positives = 28/29 (96%) Frame = +3 Query: 330 PPPPVNDTNPYNVFRPREKAHRLHTRRAE 416 PPPPVNDTNPYNVFRPREKAHRLHTRR + Sbjct: 22 PPPPVNDTNPYNVFRPREKAHRLHTRRMQ 50 >gb|KOM56125.1| hypothetical protein LR48_Vigan10g201700 [Vigna angularis] Length = 266 Score = 65.1 bits (157), Expect = 1e-09 Identities = 27/29 (93%), Positives = 28/29 (96%) Frame = +3 Query: 330 PPPPVNDTNPYNVFRPREKAHRLHTRRAE 416 PPPPVNDTNPYNVFRPREKAHRLHTRR + Sbjct: 206 PPPPVNDTNPYNVFRPREKAHRLHTRRMQ 234 >dbj|BAJ86813.1| predicted protein, partial [Hordeum vulgare subsp. vulgare] Length = 268 Score = 65.1 bits (157), Expect = 1e-09 Identities = 27/29 (93%), Positives = 28/29 (96%) Frame = +3 Query: 330 PPPPVNDTNPYNVFRPREKAHRLHTRRAE 416 PPPPVNDTNPYNVFRPREKAHRLHTRR + Sbjct: 14 PPPPVNDTNPYNVFRPREKAHRLHTRRMQ 42 >ref|XP_013651034.1| uncharacterized protein LOC106355673 [Brassica napus] Length = 279 Score = 65.1 bits (157), Expect = 1e-09 Identities = 27/29 (93%), Positives = 28/29 (96%) Frame = +3 Query: 330 PPPPVNDTNPYNVFRPREKAHRLHTRRAE 416 PPPPVNDTNPYNVFRPREKAHRLHTRR + Sbjct: 45 PPPPVNDTNPYNVFRPREKAHRLHTRRMQ 73 >gb|PKI72591.1| hypothetical protein CRG98_006968 [Punica granatum] Length = 280 Score = 65.1 bits (157), Expect = 1e-09 Identities = 27/29 (93%), Positives = 28/29 (96%) Frame = +3 Query: 330 PPPPVNDTNPYNVFRPREKAHRLHTRRAE 416 PPPPVNDTNPYNVFRPREKAHRLHTRR + Sbjct: 214 PPPPVNDTNPYNVFRPREKAHRLHTRRMQ 242 >gb|KYP40746.1| hypothetical protein KK1_037924, partial [Cajanus cajan] Length = 283 Score = 65.1 bits (157), Expect = 1e-09 Identities = 27/29 (93%), Positives = 28/29 (96%) Frame = +3 Query: 330 PPPPVNDTNPYNVFRPREKAHRLHTRRAE 416 PPPPVNDTNPYNVFRPREKAHRLHTRR + Sbjct: 29 PPPPVNDTNPYNVFRPREKAHRLHTRRMQ 57 >ref|XP_019153670.1| PREDICTED: uncharacterized protein LOC109150207 [Ipomoea nil] Length = 297 Score = 65.1 bits (157), Expect = 1e-09 Identities = 27/29 (93%), Positives = 28/29 (96%) Frame = +3 Query: 330 PPPPVNDTNPYNVFRPREKAHRLHTRRAE 416 PPPPVNDTNPYNVFRPREKAHRLHTRR + Sbjct: 50 PPPPVNDTNPYNVFRPREKAHRLHTRRMQ 78 >gb|KDO46865.1| hypothetical protein CISIN_1g0206552mg [Citrus sinensis] Length = 297 Score = 65.1 bits (157), Expect = 1e-09 Identities = 27/29 (93%), Positives = 28/29 (96%) Frame = +3 Query: 330 PPPPVNDTNPYNVFRPREKAHRLHTRRAE 416 PPPPVNDTNPYNVFRPREKAHRLHTRR + Sbjct: 226 PPPPVNDTNPYNVFRPREKAHRLHTRRMQ 254 >gb|ESR55175.1| hypothetical protein CICLE_v10021199mg [Citrus clementina] Length = 320 Score = 65.1 bits (157), Expect = 1e-09 Identities = 27/29 (93%), Positives = 28/29 (96%) Frame = +3 Query: 330 PPPPVNDTNPYNVFRPREKAHRLHTRRAE 416 PPPPVNDTNPYNVFRPREKAHRLHTRR + Sbjct: 74 PPPPVNDTNPYNVFRPREKAHRLHTRRMQ 102 >gb|KDO46864.1| hypothetical protein CISIN_1g0206552mg [Citrus sinensis] Length = 323 Score = 65.1 bits (157), Expect = 1e-09 Identities = 27/29 (93%), Positives = 28/29 (96%) Frame = +3 Query: 330 PPPPVNDTNPYNVFRPREKAHRLHTRRAE 416 PPPPVNDTNPYNVFRPREKAHRLHTRR + Sbjct: 226 PPPPVNDTNPYNVFRPREKAHRLHTRRMQ 254 >gb|KRH18236.1| hypothetical protein GLYMA_13G045600 [Glycine max] Length = 326 Score = 65.1 bits (157), Expect = 2e-09 Identities = 27/29 (93%), Positives = 28/29 (96%) Frame = +3 Query: 330 PPPPVNDTNPYNVFRPREKAHRLHTRRAE 416 PPPPVNDTNPYNVFRPREKAHRLHTRR + Sbjct: 78 PPPPVNDTNPYNVFRPREKAHRLHTRRMQ 106 >ref|XP_010247400.2| PREDICTED: enhancer of polycomb-like protein 1 isoform X2 [Nelumbo nucifera] Length = 369 Score = 65.1 bits (157), Expect = 2e-09 Identities = 27/29 (93%), Positives = 28/29 (96%) Frame = +3 Query: 330 PPPPVNDTNPYNVFRPREKAHRLHTRRAE 416 PPPPVNDTNPYNVFRPREKAHRLHTRR + Sbjct: 205 PPPPVNDTNPYNVFRPREKAHRLHTRRMQ 233