BLASTX nr result
ID: Chrysanthemum21_contig00009911
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00009911 (674 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_021981790.1| regulator of nonsense transcripts UPF3-like ... 75 7e-12 ref|XP_022027837.1| regulator of nonsense transcripts UPF3-like ... 72 4e-11 ref|XP_022027836.1| regulator of nonsense transcripts UPF3-like ... 72 4e-11 ref|XP_020250110.1| regulator of nonsense transcripts UPF3-like ... 64 3e-08 dbj|GAV63295.1| Smg4_UPF3 domain-containing protein [Cephalotus ... 64 3e-08 ref|XP_021970825.1| regulator of nonsense transcripts UPF3-like ... 61 4e-07 ref|XP_017234881.1| PREDICTED: regulator of nonsense transcripts... 61 4e-07 gb|PKA66757.1| Regulator of nonsense transcripts UPF3 [Apostasia... 60 5e-07 ref|XP_023731231.1| regulator of nonsense transcripts UPF3-like ... 59 1e-06 ref|XP_017227081.1| PREDICTED: regulator of nonsense transcripts... 59 2e-06 ref|XP_023535567.1| regulator of nonsense transcripts UPF3-like ... 58 4e-06 ref|XP_022973974.1| regulator of nonsense transcripts UPF3-like ... 58 4e-06 gb|OWM84867.1| hypothetical protein CDL15_Pgr027654 [Punica gran... 57 7e-06 ref|XP_008802926.1| PREDICTED: regulator of nonsense transcripts... 57 8e-06 ref|XP_008802925.1| PREDICTED: regulator of nonsense transcripts... 57 8e-06 ref|XP_008802922.1| PREDICTED: regulator of nonsense transcripts... 57 8e-06 gb|OTG30754.1| putative regulator of nonsense-mediated decay, UP... 48 9e-06 >ref|XP_021981790.1| regulator of nonsense transcripts UPF3-like [Helianthus annuus] Length = 487 Score = 74.7 bits (182), Expect = 7e-12 Identities = 34/39 (87%), Positives = 37/39 (94%) Frame = +3 Query: 3 KDADGSLNLNEGKPSKRGVSSGYVSHEKRVWVQKPSSGS 119 KDADGS N+N+GKPSKRGVS+GY SHEKRVWVQKPSSGS Sbjct: 449 KDADGSSNVNDGKPSKRGVSAGYGSHEKRVWVQKPSSGS 487 >ref|XP_022027837.1| regulator of nonsense transcripts UPF3-like isoform X2 [Helianthus annuus] Length = 437 Score = 72.4 bits (176), Expect = 4e-11 Identities = 34/39 (87%), Positives = 35/39 (89%) Frame = +3 Query: 3 KDADGSLNLNEGKPSKRGVSSGYVSHEKRVWVQKPSSGS 119 KDADGS N NEGKP KRGVS+GY SHEKRVWVQKPSSGS Sbjct: 399 KDADGSSNSNEGKPLKRGVSAGYGSHEKRVWVQKPSSGS 437 >ref|XP_022027836.1| regulator of nonsense transcripts UPF3-like isoform X1 [Helianthus annuus] Length = 469 Score = 72.4 bits (176), Expect = 4e-11 Identities = 34/39 (87%), Positives = 35/39 (89%) Frame = +3 Query: 3 KDADGSLNLNEGKPSKRGVSSGYVSHEKRVWVQKPSSGS 119 KDADGS N NEGKP KRGVS+GY SHEKRVWVQKPSSGS Sbjct: 431 KDADGSSNSNEGKPLKRGVSAGYGSHEKRVWVQKPSSGS 469 >ref|XP_020250110.1| regulator of nonsense transcripts UPF3-like [Asparagus officinalis] gb|ONK55322.1| uncharacterized protein A4U43_UnF5010 [Asparagus officinalis] Length = 554 Score = 64.3 bits (155), Expect = 3e-08 Identities = 28/39 (71%), Positives = 33/39 (84%) Frame = +3 Query: 3 KDADGSLNLNEGKPSKRGVSSGYVSHEKRVWVQKPSSGS 119 KD DGS+N +EGKP KRG+S+GY SHEK+VWVQK SGS Sbjct: 516 KDMDGSVNFSEGKPCKRGISAGYGSHEKQVWVQKSGSGS 554 >dbj|GAV63295.1| Smg4_UPF3 domain-containing protein [Cephalotus follicularis] Length = 522 Score = 63.9 bits (154), Expect = 3e-08 Identities = 30/39 (76%), Positives = 34/39 (87%) Frame = +3 Query: 3 KDADGSLNLNEGKPSKRGVSSGYVSHEKRVWVQKPSSGS 119 KDADGSL ++GKP KRG +SGYVSHEK+VWVQK SSGS Sbjct: 484 KDADGSLVASDGKPLKRGGASGYVSHEKQVWVQKSSSGS 522 >ref|XP_021970825.1| regulator of nonsense transcripts UPF3-like [Helianthus annuus] Length = 483 Score = 60.8 bits (146), Expect = 4e-07 Identities = 31/39 (79%), Positives = 32/39 (82%) Frame = +3 Query: 3 KDADGSLNLNEGKPSKRGVSSGYVSHEKRVWVQKPSSGS 119 KDADG L EGKP KRGVSSGY SHEK+VWVQK SSGS Sbjct: 448 KDADG---LTEGKPLKRGVSSGYSSHEKQVWVQKSSSGS 483 >ref|XP_017234881.1| PREDICTED: regulator of nonsense transcripts UPF3-like [Daucus carota subsp. sativus] gb|KZN05826.1| hypothetical protein DCAR_006663 [Daucus carota subsp. sativus] Length = 503 Score = 60.8 bits (146), Expect = 4e-07 Identities = 27/39 (69%), Positives = 32/39 (82%) Frame = +3 Query: 3 KDADGSLNLNEGKPSKRGVSSGYVSHEKRVWVQKPSSGS 119 KD DG + + EGKP K+G+SSGY SHEK+VWVQK SSGS Sbjct: 465 KDTDGPMIIGEGKPFKKGLSSGYSSHEKQVWVQKSSSGS 503 >gb|PKA66757.1| Regulator of nonsense transcripts UPF3 [Apostasia shenzhenica] Length = 504 Score = 60.5 bits (145), Expect = 5e-07 Identities = 27/39 (69%), Positives = 30/39 (76%) Frame = +3 Query: 3 KDADGSLNLNEGKPSKRGVSSGYVSHEKRVWVQKPSSGS 119 KD D SLN EGKPSKRG S+GY HE++VWVQK SGS Sbjct: 466 KDVDASLNATEGKPSKRGGSTGYAPHERQVWVQKSGSGS 504 >ref|XP_023731231.1| regulator of nonsense transcripts UPF3-like [Lactuca sativa] Length = 467 Score = 59.3 bits (142), Expect = 1e-06 Identities = 31/39 (79%), Positives = 31/39 (79%) Frame = +3 Query: 3 KDADGSLNLNEGKPSKRGVSSGYVSHEKRVWVQKPSSGS 119 KDAD N NEGKP KRGVSSGY EKRVWVQKPSSGS Sbjct: 432 KDADVFSNSNEGKPPKRGVSSGY---EKRVWVQKPSSGS 467 >ref|XP_017227081.1| PREDICTED: regulator of nonsense transcripts UPF3 [Daucus carota subsp. sativus] ref|XP_017227082.1| PREDICTED: regulator of nonsense transcripts UPF3 [Daucus carota subsp. sativus] Length = 522 Score = 58.9 bits (141), Expect = 2e-06 Identities = 29/39 (74%), Positives = 31/39 (79%) Frame = +3 Query: 3 KDADGSLNLNEGKPSKRGVSSGYVSHEKRVWVQKPSSGS 119 KDADGSLNL E KP KRG SG+ S EK+VWVQK SSGS Sbjct: 484 KDADGSLNLGEAKPLKRGNFSGHGSQEKQVWVQKSSSGS 522 >ref|XP_023535567.1| regulator of nonsense transcripts UPF3-like [Cucurbita pepo subsp. pepo] Length = 513 Score = 57.8 bits (138), Expect = 4e-06 Identities = 29/36 (80%), Positives = 31/36 (86%) Frame = +3 Query: 12 DGSLNLNEGKPSKRGVSSGYVSHEKRVWVQKPSSGS 119 DGSLN NEGKPSKRGV+SG HEK+VWVQK SSGS Sbjct: 481 DGSLNPNEGKPSKRGVASG---HEKQVWVQKSSSGS 513 >ref|XP_022973974.1| regulator of nonsense transcripts UPF3-like [Cucurbita maxima] Length = 513 Score = 57.8 bits (138), Expect = 4e-06 Identities = 29/36 (80%), Positives = 31/36 (86%) Frame = +3 Query: 12 DGSLNLNEGKPSKRGVSSGYVSHEKRVWVQKPSSGS 119 DGSLN NEGKPSKRGV+SG HEK+VWVQK SSGS Sbjct: 481 DGSLNPNEGKPSKRGVASG---HEKQVWVQKSSSGS 513 >gb|OWM84867.1| hypothetical protein CDL15_Pgr027654 [Punica granatum] Length = 481 Score = 57.0 bits (136), Expect = 7e-06 Identities = 28/39 (71%), Positives = 30/39 (76%) Frame = +3 Query: 3 KDADGSLNLNEGKPSKRGVSSGYVSHEKRVWVQKPSSGS 119 KD DGS EGKPSKRG + GY SHEK+VWVQK SSGS Sbjct: 443 KDLDGSPISTEGKPSKRGGALGYGSHEKQVWVQKSSSGS 481 >ref|XP_008802926.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform X3 [Phoenix dactylifera] Length = 567 Score = 57.0 bits (136), Expect = 8e-06 Identities = 25/39 (64%), Positives = 31/39 (79%) Frame = +3 Query: 3 KDADGSLNLNEGKPSKRGVSSGYVSHEKRVWVQKPSSGS 119 K+ D SLN +EGKPSKRG +GY SHE++VWVQK SG+ Sbjct: 529 KEVDASLNYHEGKPSKRGGPAGYGSHERQVWVQKSGSGT 567 >ref|XP_008802925.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform X2 [Phoenix dactylifera] Length = 568 Score = 57.0 bits (136), Expect = 8e-06 Identities = 25/39 (64%), Positives = 31/39 (79%) Frame = +3 Query: 3 KDADGSLNLNEGKPSKRGVSSGYVSHEKRVWVQKPSSGS 119 K+ D SLN +EGKPSKRG +GY SHE++VWVQK SG+ Sbjct: 530 KEVDASLNYHEGKPSKRGGPAGYGSHERQVWVQKSGSGT 568 >ref|XP_008802922.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform X1 [Phoenix dactylifera] ref|XP_008802923.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform X1 [Phoenix dactylifera] ref|XP_008802924.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform X1 [Phoenix dactylifera] Length = 570 Score = 57.0 bits (136), Expect = 8e-06 Identities = 25/39 (64%), Positives = 31/39 (79%) Frame = +3 Query: 3 KDADGSLNLNEGKPSKRGVSSGYVSHEKRVWVQKPSSGS 119 K+ D SLN +EGKPSKRG +GY SHE++VWVQK SG+ Sbjct: 532 KEVDASLNYHEGKPSKRGGPAGYGSHERQVWVQKSGSGT 570 >gb|OTG30754.1| putative regulator of nonsense-mediated decay, UPF3 [Helianthus annuus] Length = 478 Score = 47.8 bits (112), Expect(2) = 9e-06 Identities = 22/27 (81%), Positives = 23/27 (85%) Frame = +3 Query: 3 KDADGSLNLNEGKPSKRGVSSGYVSHE 83 KDADGS N NEGKP KRGVS+GY SHE Sbjct: 431 KDADGSSNSNEGKPLKRGVSAGYGSHE 457 Score = 30.0 bits (66), Expect(2) = 9e-06 Identities = 12/18 (66%), Positives = 15/18 (83%) Frame = +1 Query: 85 SECGFKSQAPVLRCVSKL 138 SECGF++Q VLRC +KL Sbjct: 459 SECGFRNQVLVLRCFNKL 476