BLASTX nr result
ID: Chrysanthemum21_contig00009711
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00009711 (429 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KVH99693.1| GDP-fucose protein O-fucosyltransferase [Cynara c... 81 3e-15 ref|XP_023750472.1| O-fucosyltransferase 31 [Lactuca sativa] >gi... 81 6e-15 ref|XP_022039860.1| uncharacterized protein At1g04910 [Helianthu... 80 8e-15 gb|AHH02360.1| hypothetical protein, partial [Aegiceras cornicul... 73 6e-14 dbj|GAV66834.1| O-FucT domain-containing protein [Cephalotus fol... 78 7e-14 ref|XP_012845114.1| PREDICTED: uncharacterized protein At1g04910... 77 1e-13 ref|XP_012845113.1| PREDICTED: uncharacterized protein At1g04910... 77 1e-13 gb|EYU30935.1| hypothetical protein MIMGU_mgv1a004530mg [Erythra... 77 1e-13 ref|XP_010254530.1| PREDICTED: uncharacterized protein At1g04910... 77 2e-13 ref|XP_008802622.1| PREDICTED: uncharacterized protein At1g04910... 76 2e-13 ref|XP_010939815.2| PREDICTED: uncharacterized protein At1g04910... 76 2e-13 gb|PIN01164.1| hypothetical protein CDL12_26332 [Handroanthus im... 76 2e-13 gb|PIN09745.1| hypothetical protein CDL12_17671 [Handroanthus im... 75 3e-13 gb|ERN14410.1| hypothetical protein AMTR_s00033p00238220 [Ambore... 76 3e-13 ref|XP_020528203.1| uncharacterized protein At1g04910 [Amborella... 76 3e-13 emb|CDP11502.1| unnamed protein product [Coffea canephora] 76 3e-13 ref|XP_022843225.1| O-fucosyltransferase 39-like [Olea europaea ... 75 4e-13 ref|XP_015890597.1| PREDICTED: uncharacterized protein At1g04910... 75 4e-13 gb|OWM66209.1| hypothetical protein CDL15_Pgr013426 [Punica gran... 75 4e-13 ref|XP_020087318.1| uncharacterized protein At1g04910-like [Anan... 75 4e-13 >gb|KVH99693.1| GDP-fucose protein O-fucosyltransferase [Cynara cardunculus var. scolymus] Length = 369 Score = 81.3 bits (199), Expect = 3e-15 Identities = 38/40 (95%), Positives = 38/40 (95%) Frame = -1 Query: 120 SHGIAAIAPFSHRLGFDNLPKEIQLLRCKVNFQALVFVPH 1 SHGIAAIAPFSHRL FDNLPKEIQLLRCKVNFQAL FVPH Sbjct: 185 SHGIAAIAPFSHRLAFDNLPKEIQLLRCKVNFQALSFVPH 224 >ref|XP_023750472.1| O-fucosyltransferase 31 [Lactuca sativa] gb|PLY95531.1| hypothetical protein LSAT_6X105021 [Lactuca sativa] Length = 500 Score = 80.9 bits (198), Expect = 6e-15 Identities = 37/40 (92%), Positives = 39/40 (97%) Frame = -1 Query: 120 SHGIAAIAPFSHRLGFDNLPKEIQLLRCKVNFQALVFVPH 1 SHGIAAIAPFSHRL FDNLP+EIQLLRCKVNF+ALVFVPH Sbjct: 213 SHGIAAIAPFSHRLAFDNLPEEIQLLRCKVNFEALVFVPH 252 >ref|XP_022039860.1| uncharacterized protein At1g04910 [Helianthus annuus] gb|OTG26862.1| putative O-fucosyltransferase family protein [Helianthus annuus] Length = 504 Score = 80.5 bits (197), Expect = 8e-15 Identities = 37/40 (92%), Positives = 37/40 (92%) Frame = -1 Query: 120 SHGIAAIAPFSHRLGFDNLPKEIQLLRCKVNFQALVFVPH 1 SHGI AIAPFSHRL FDNLPKEIQLLRCKVNFQAL FVPH Sbjct: 213 SHGIVAIAPFSHRLAFDNLPKEIQLLRCKVNFQALAFVPH 252 >gb|AHH02360.1| hypothetical protein, partial [Aegiceras corniculatum] Length = 100 Score = 72.8 bits (177), Expect = 6e-14 Identities = 33/39 (84%), Positives = 37/39 (94%) Frame = -1 Query: 117 HGIAAIAPFSHRLGFDNLPKEIQLLRCKVNFQALVFVPH 1 +GIAAIAPFSHRL FD+LPK+IQ LRCKVNF+ALVFVPH Sbjct: 1 YGIAAIAPFSHRLAFDDLPKDIQRLRCKVNFKALVFVPH 39 >dbj|GAV66834.1| O-FucT domain-containing protein [Cephalotus follicularis] Length = 510 Score = 77.8 bits (190), Expect = 7e-14 Identities = 36/40 (90%), Positives = 37/40 (92%) Frame = -1 Query: 120 SHGIAAIAPFSHRLGFDNLPKEIQLLRCKVNFQALVFVPH 1 SHGIAAIAPFSHRL FDNLP +IQ LRCKVNFQALVFVPH Sbjct: 214 SHGIAAIAPFSHRLAFDNLPDDIQRLRCKVNFQALVFVPH 253 >ref|XP_012845114.1| PREDICTED: uncharacterized protein At1g04910-like isoform X2 [Erythranthe guttata] gb|EYU30936.1| hypothetical protein MIMGU_mgv1a004530mg [Erythranthe guttata] gb|EYU30937.1| hypothetical protein MIMGU_mgv1a004530mg [Erythranthe guttata] Length = 511 Score = 77.0 bits (188), Expect = 1e-13 Identities = 35/40 (87%), Positives = 38/40 (95%) Frame = -1 Query: 120 SHGIAAIAPFSHRLGFDNLPKEIQLLRCKVNFQALVFVPH 1 S+GIAAIAPFSHRL FDN+PKEIQ LRCKVNFQALV+VPH Sbjct: 211 SYGIAAIAPFSHRLAFDNMPKEIQRLRCKVNFQALVYVPH 250 >ref|XP_012845113.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 [Erythranthe guttata] Length = 512 Score = 77.0 bits (188), Expect = 1e-13 Identities = 35/40 (87%), Positives = 38/40 (95%) Frame = -1 Query: 120 SHGIAAIAPFSHRLGFDNLPKEIQLLRCKVNFQALVFVPH 1 S+GIAAIAPFSHRL FDN+PKEIQ LRCKVNFQALV+VPH Sbjct: 212 SYGIAAIAPFSHRLAFDNMPKEIQRLRCKVNFQALVYVPH 251 >gb|EYU30935.1| hypothetical protein MIMGU_mgv1a004530mg [Erythranthe guttata] Length = 522 Score = 77.0 bits (188), Expect = 1e-13 Identities = 35/40 (87%), Positives = 38/40 (95%) Frame = -1 Query: 120 SHGIAAIAPFSHRLGFDNLPKEIQLLRCKVNFQALVFVPH 1 S+GIAAIAPFSHRL FDN+PKEIQ LRCKVNFQALV+VPH Sbjct: 211 SYGIAAIAPFSHRLAFDNMPKEIQRLRCKVNFQALVYVPH 250 >ref|XP_010254530.1| PREDICTED: uncharacterized protein At1g04910-like [Nelumbo nucifera] Length = 522 Score = 76.6 bits (187), Expect = 2e-13 Identities = 36/40 (90%), Positives = 37/40 (92%) Frame = -1 Query: 120 SHGIAAIAPFSHRLGFDNLPKEIQLLRCKVNFQALVFVPH 1 S+GIAAIAPFSHRL FDNLP EIQ LRCKVNFQALVFVPH Sbjct: 213 SYGIAAIAPFSHRLAFDNLPMEIQRLRCKVNFQALVFVPH 252 >ref|XP_008802622.1| PREDICTED: uncharacterized protein At1g04910-like, partial [Phoenix dactylifera] Length = 495 Score = 76.3 bits (186), Expect = 2e-13 Identities = 36/40 (90%), Positives = 37/40 (92%) Frame = -1 Query: 120 SHGIAAIAPFSHRLGFDNLPKEIQLLRCKVNFQALVFVPH 1 S+GIAAIAPFSHRL FDNLP EIQ LRCKVNFQALVFVPH Sbjct: 257 SYGIAAIAPFSHRLAFDNLPGEIQRLRCKVNFQALVFVPH 296 >ref|XP_010939815.2| PREDICTED: uncharacterized protein At1g04910 [Elaeis guineensis] Length = 513 Score = 76.3 bits (186), Expect = 2e-13 Identities = 36/40 (90%), Positives = 37/40 (92%) Frame = -1 Query: 120 SHGIAAIAPFSHRLGFDNLPKEIQLLRCKVNFQALVFVPH 1 S+GIAAIAPFSHRL FDNLP EIQ LRCKVNFQALVFVPH Sbjct: 215 SYGIAAIAPFSHRLAFDNLPGEIQRLRCKVNFQALVFVPH 254 >gb|PIN01164.1| hypothetical protein CDL12_26332 [Handroanthus impetiginosus] Length = 516 Score = 76.3 bits (186), Expect = 2e-13 Identities = 34/40 (85%), Positives = 38/40 (95%) Frame = -1 Query: 120 SHGIAAIAPFSHRLGFDNLPKEIQLLRCKVNFQALVFVPH 1 S+GIAAIAPFSHRL FDN+P+EIQ LRCKVNFQAL+FVPH Sbjct: 215 SYGIAAIAPFSHRLAFDNMPEEIQRLRCKVNFQALIFVPH 254 >gb|PIN09745.1| hypothetical protein CDL12_17671 [Handroanthus impetiginosus] Length = 343 Score = 75.5 bits (184), Expect = 3e-13 Identities = 34/40 (85%), Positives = 38/40 (95%) Frame = -1 Query: 120 SHGIAAIAPFSHRLGFDNLPKEIQLLRCKVNFQALVFVPH 1 S+GIAAIAPFSHRL FDN+P++IQ LRCKVNFQALVFVPH Sbjct: 140 SYGIAAIAPFSHRLAFDNMPEDIQRLRCKVNFQALVFVPH 179 >gb|ERN14410.1| hypothetical protein AMTR_s00033p00238220 [Amborella trichopoda] Length = 446 Score = 75.9 bits (185), Expect = 3e-13 Identities = 34/40 (85%), Positives = 37/40 (92%) Frame = -1 Query: 120 SHGIAAIAPFSHRLGFDNLPKEIQLLRCKVNFQALVFVPH 1 S+GIAA+APFSHRL FDNLPKEIQ LRCKVNF+AL FVPH Sbjct: 149 SYGIAAVAPFSHRLAFDNLPKEIQRLRCKVNFEALAFVPH 188 >ref|XP_020528203.1| uncharacterized protein At1g04910 [Amborella trichopoda] Length = 460 Score = 75.9 bits (185), Expect = 3e-13 Identities = 34/40 (85%), Positives = 37/40 (92%) Frame = -1 Query: 120 SHGIAAIAPFSHRLGFDNLPKEIQLLRCKVNFQALVFVPH 1 S+GIAA+APFSHRL FDNLPKEIQ LRCKVNF+AL FVPH Sbjct: 163 SYGIAAVAPFSHRLAFDNLPKEIQRLRCKVNFEALAFVPH 202 >emb|CDP11502.1| unnamed protein product [Coffea canephora] Length = 515 Score = 75.9 bits (185), Expect = 3e-13 Identities = 35/40 (87%), Positives = 37/40 (92%) Frame = -1 Query: 120 SHGIAAIAPFSHRLGFDNLPKEIQLLRCKVNFQALVFVPH 1 S+GIAAIAPFSHRL FDNLP EIQ LRCKVNF+ALVFVPH Sbjct: 216 SYGIAAIAPFSHRLAFDNLPSEIQQLRCKVNFEALVFVPH 255 >ref|XP_022843225.1| O-fucosyltransferase 39-like [Olea europaea var. sylvestris] Length = 438 Score = 75.5 bits (184), Expect = 4e-13 Identities = 34/39 (87%), Positives = 37/39 (94%) Frame = -1 Query: 117 HGIAAIAPFSHRLGFDNLPKEIQLLRCKVNFQALVFVPH 1 +GIAAIAPFSHRL FDN+PK+IQ LRCKVNFQALVFVPH Sbjct: 139 YGIAAIAPFSHRLAFDNMPKDIQRLRCKVNFQALVFVPH 177 >ref|XP_015890597.1| PREDICTED: uncharacterized protein At1g04910 isoform X2 [Ziziphus jujuba] Length = 493 Score = 75.5 bits (184), Expect = 4e-13 Identities = 35/40 (87%), Positives = 37/40 (92%) Frame = -1 Query: 120 SHGIAAIAPFSHRLGFDNLPKEIQLLRCKVNFQALVFVPH 1 S+GIAAIAPFSHRL FDNLP +IQ LRCKVNFQALVFVPH Sbjct: 196 SYGIAAIAPFSHRLAFDNLPMDIQRLRCKVNFQALVFVPH 235 >gb|OWM66209.1| hypothetical protein CDL15_Pgr013426 [Punica granatum] Length = 500 Score = 75.5 bits (184), Expect = 4e-13 Identities = 35/40 (87%), Positives = 36/40 (90%) Frame = -1 Query: 120 SHGIAAIAPFSHRLGFDNLPKEIQLLRCKVNFQALVFVPH 1 SHGIAAIAPFSHRL FDNLP E+Q LRCKVNFQAL FVPH Sbjct: 200 SHGIAAIAPFSHRLTFDNLPMEMQKLRCKVNFQALTFVPH 239 >ref|XP_020087318.1| uncharacterized protein At1g04910-like [Ananas comosus] Length = 511 Score = 75.5 bits (184), Expect = 4e-13 Identities = 34/40 (85%), Positives = 38/40 (95%) Frame = -1 Query: 120 SHGIAAIAPFSHRLGFDNLPKEIQLLRCKVNFQALVFVPH 1 S+GIAAI+PFSHRL FD+LPKEIQ LRCKVNFQAL+FVPH Sbjct: 213 SYGIAAISPFSHRLAFDDLPKEIQQLRCKVNFQALIFVPH 252