BLASTX nr result
ID: Chrysanthemum21_contig00009660
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00009660 (473 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_019186106.1| PREDICTED: protein transport protein SEC31 h... 61 7e-08 ref|XP_021976602.1| protein transport protein SEC31 homolog B-li... 60 1e-07 ref|XP_010523659.1| PREDICTED: protein transport protein SEC31 h... 60 1e-07 ref|XP_010523658.1| PREDICTED: protein transport protein SEC31 h... 60 1e-07 gb|KVH97345.1| Steroid receptor RNA activator-protein/coat prote... 60 1e-07 ref|XP_021970879.1| protein transport protein SEC31 homolog B-li... 60 2e-07 ref|XP_021970878.1| protein transport protein SEC31 homolog B-li... 60 2e-07 ref|XP_017615686.1| PREDICTED: protein transport protein SEC31 h... 60 2e-07 gb|KHG28628.1| Protein transport Sec31A [Gossypium arboreum] 60 2e-07 gb|KVI00734.1| hypothetical protein Ccrd_021012 [Cynara carduncu... 59 3e-07 gb|PPD81701.1| hypothetical protein GOBAR_DD21377 [Gossypium bar... 59 3e-07 ref|XP_012437576.1| PREDICTED: protein transport protein SEC31 h... 59 3e-07 ref|XP_012437575.1| PREDICTED: protein transport protein SEC31 h... 59 3e-07 ref|XP_016735141.1| PREDICTED: protein transport protein SEC31 h... 59 3e-07 ref|XP_012437574.1| PREDICTED: protein transport protein SEC31 h... 59 3e-07 ref|XP_017637957.1| PREDICTED: protein transport protein SEC31 h... 59 3e-07 gb|PPE00146.1| hypothetical protein GOBAR_DD02799 [Gossypium bar... 59 3e-07 gb|PPR80409.1| hypothetical protein GOBAR_AA40308 [Gossypium bar... 59 3e-07 ref|XP_022018235.1| protein transport protein SEC31 homolog B-li... 59 6e-07 ref|XP_022770128.1| protein transport protein SEC31 homolog B-li... 59 6e-07 >ref|XP_019186106.1| PREDICTED: protein transport protein SEC31 homolog B-like [Ipomoea nil] Length = 1123 Score = 61.2 bits (147), Expect = 7e-08 Identities = 29/39 (74%), Positives = 31/39 (79%) Frame = +3 Query: 87 DERGTWGHLKVMFEDDGTTRMKLLNHLGFSLLAEEVNDT 203 DER TWG LKVMFEDDGT R KLL+HLGFSL EE + T Sbjct: 439 DERETWGFLKVMFEDDGTARTKLLSHLGFSLPVEEKDTT 477 >ref|XP_021976602.1| protein transport protein SEC31 homolog B-like [Helianthus annuus] gb|OTG37148.1| putative WD40/YVTN repeat-like-containing domain, Ancestral coatomer element 1, Sec16/Sec31 [Helianthus annuus] Length = 1094 Score = 60.5 bits (145), Expect = 1e-07 Identities = 28/37 (75%), Positives = 30/37 (81%) Frame = +3 Query: 87 DERGTWGHLKVMFEDDGTTRMKLLNHLGFSLLAEEVN 197 D++ TWG LKVMFEDDGT R KLLNHLGFSL EE N Sbjct: 435 DDKETWGLLKVMFEDDGTARTKLLNHLGFSLPTEEQN 471 >ref|XP_010523659.1| PREDICTED: protein transport protein SEC31 homolog B-like isoform X2 [Tarenaya hassleriana] Length = 1103 Score = 60.5 bits (145), Expect = 1e-07 Identities = 27/35 (77%), Positives = 31/35 (88%) Frame = +3 Query: 87 DERGTWGHLKVMFEDDGTTRMKLLNHLGFSLLAEE 191 +E+ TWG LK MFED+GTTR KLLNHLGFSLL+EE Sbjct: 438 EEKETWGLLKTMFEDEGTTRTKLLNHLGFSLLSEE 472 >ref|XP_010523658.1| PREDICTED: protein transport protein SEC31 homolog B-like isoform X1 [Tarenaya hassleriana] Length = 1107 Score = 60.5 bits (145), Expect = 1e-07 Identities = 27/35 (77%), Positives = 31/35 (88%) Frame = +3 Query: 87 DERGTWGHLKVMFEDDGTTRMKLLNHLGFSLLAEE 191 +E+ TWG LK MFED+GTTR KLLNHLGFSLL+EE Sbjct: 438 EEKETWGLLKTMFEDEGTTRTKLLNHLGFSLLSEE 472 >gb|KVH97345.1| Steroid receptor RNA activator-protein/coat protein complex II, Sec31 [Cynara cardunculus var. scolymus] Length = 1176 Score = 60.5 bits (145), Expect = 1e-07 Identities = 28/34 (82%), Positives = 29/34 (85%) Frame = +3 Query: 87 DERGTWGHLKVMFEDDGTTRMKLLNHLGFSLLAE 188 D+R TWG LKVMFEDDGT R KLLNHLGFSL AE Sbjct: 472 DDRETWGFLKVMFEDDGTARTKLLNHLGFSLPAE 505 >ref|XP_021970879.1| protein transport protein SEC31 homolog B-like isoform X2 [Helianthus annuus] Length = 1100 Score = 60.1 bits (144), Expect = 2e-07 Identities = 29/39 (74%), Positives = 33/39 (84%) Frame = +3 Query: 87 DERGTWGHLKVMFEDDGTTRMKLLNHLGFSLLAEEVNDT 203 D++ TWG LKVMFEDDGT R KLLNHLGF+L A EVN+T Sbjct: 438 DDKETWGFLKVMFEDDGTARTKLLNHLGFTLPA-EVNET 475 >ref|XP_021970878.1| protein transport protein SEC31 homolog B-like isoform X1 [Helianthus annuus] gb|OTG23516.1| putative WD40/YVTN repeat-like-containing domain, Ancestral coatomer element 1, Sec16/Sec31 [Helianthus annuus] Length = 1102 Score = 60.1 bits (144), Expect = 2e-07 Identities = 29/39 (74%), Positives = 33/39 (84%) Frame = +3 Query: 87 DERGTWGHLKVMFEDDGTTRMKLLNHLGFSLLAEEVNDT 203 D++ TWG LKVMFEDDGT R KLLNHLGF+L A EVN+T Sbjct: 438 DDKETWGFLKVMFEDDGTARTKLLNHLGFTLPA-EVNET 475 >ref|XP_017615686.1| PREDICTED: protein transport protein SEC31 homolog B-like [Gossypium arboreum] Length = 1111 Score = 60.1 bits (144), Expect = 2e-07 Identities = 28/35 (80%), Positives = 29/35 (82%) Frame = +3 Query: 87 DERGTWGHLKVMFEDDGTTRMKLLNHLGFSLLAEE 191 D+R TWG LKVMFEDDGT R KLL HLGFSL AEE Sbjct: 437 DDRETWGFLKVMFEDDGTVRTKLLMHLGFSLTAEE 471 >gb|KHG28628.1| Protein transport Sec31A [Gossypium arboreum] Length = 1120 Score = 60.1 bits (144), Expect = 2e-07 Identities = 28/35 (80%), Positives = 29/35 (82%) Frame = +3 Query: 87 DERGTWGHLKVMFEDDGTTRMKLLNHLGFSLLAEE 191 D+R TWG LKVMFEDDGT R KLL HLGFSL AEE Sbjct: 446 DDRETWGFLKVMFEDDGTVRTKLLMHLGFSLTAEE 480 >gb|KVI00734.1| hypothetical protein Ccrd_021012 [Cynara cardunculus var. scolymus] Length = 1070 Score = 59.3 bits (142), Expect = 3e-07 Identities = 29/39 (74%), Positives = 31/39 (79%) Frame = +3 Query: 87 DERGTWGHLKVMFEDDGTTRMKLLNHLGFSLLAEEVNDT 203 D+R WG LKVMFEDDGT R KLLNHLGFS L E+NDT Sbjct: 421 DDREIWGFLKVMFEDDGTARTKLLNHLGFS-LPPELNDT 458 >gb|PPD81701.1| hypothetical protein GOBAR_DD21377 [Gossypium barbadense] Length = 1080 Score = 59.3 bits (142), Expect = 3e-07 Identities = 28/35 (80%), Positives = 29/35 (82%) Frame = +3 Query: 87 DERGTWGHLKVMFEDDGTTRMKLLNHLGFSLLAEE 191 D+R TWG LKVMFEDDGT R KLL HLGFSL AEE Sbjct: 436 DDRETWGFLKVMFEDDGTARTKLLMHLGFSLPAEE 470 >ref|XP_012437576.1| PREDICTED: protein transport protein SEC31 homolog B-like isoform X3 [Gossypium raimondii] gb|KJB49308.1| hypothetical protein B456_008G112200 [Gossypium raimondii] Length = 1080 Score = 59.3 bits (142), Expect = 3e-07 Identities = 28/35 (80%), Positives = 29/35 (82%) Frame = +3 Query: 87 DERGTWGHLKVMFEDDGTTRMKLLNHLGFSLLAEE 191 D+R TWG LKVMFEDDGT R KLL HLGFSL AEE Sbjct: 437 DDRETWGFLKVMFEDDGTARTKLLMHLGFSLPAEE 471 >ref|XP_012437575.1| PREDICTED: protein transport protein SEC31 homolog B-like isoform X2 [Gossypium raimondii] Length = 1110 Score = 59.3 bits (142), Expect = 3e-07 Identities = 28/35 (80%), Positives = 29/35 (82%) Frame = +3 Query: 87 DERGTWGHLKVMFEDDGTTRMKLLNHLGFSLLAEE 191 D+R TWG LKVMFEDDGT R KLL HLGFSL AEE Sbjct: 437 DDRETWGFLKVMFEDDGTARTKLLMHLGFSLPAEE 471 >ref|XP_016735141.1| PREDICTED: protein transport protein SEC31 homolog B-like [Gossypium hirsutum] Length = 1111 Score = 59.3 bits (142), Expect = 3e-07 Identities = 28/35 (80%), Positives = 29/35 (82%) Frame = +3 Query: 87 DERGTWGHLKVMFEDDGTTRMKLLNHLGFSLLAEE 191 D+R TWG LKVMFEDDGT R KLL HLGFSL AEE Sbjct: 437 DDRETWGFLKVMFEDDGTARTKLLMHLGFSLPAEE 471 >ref|XP_012437574.1| PREDICTED: protein transport protein SEC31 homolog B-like isoform X1 [Gossypium raimondii] gb|KJB49307.1| hypothetical protein B456_008G112200 [Gossypium raimondii] Length = 1111 Score = 59.3 bits (142), Expect = 3e-07 Identities = 28/35 (80%), Positives = 29/35 (82%) Frame = +3 Query: 87 DERGTWGHLKVMFEDDGTTRMKLLNHLGFSLLAEE 191 D+R TWG LKVMFEDDGT R KLL HLGFSL AEE Sbjct: 437 DDRETWGFLKVMFEDDGTARTKLLMHLGFSLPAEE 471 >ref|XP_017637957.1| PREDICTED: protein transport protein SEC31 homolog B-like [Gossypium arboreum] gb|KHG13502.1| Protein transport SEC31 [Gossypium arboreum] Length = 1111 Score = 59.3 bits (142), Expect = 3e-07 Identities = 28/35 (80%), Positives = 29/35 (82%) Frame = +3 Query: 87 DERGTWGHLKVMFEDDGTTRMKLLNHLGFSLLAEE 191 D+R TWG LKVMFEDDGT R KLL HLGFSL AEE Sbjct: 437 DDRETWGFLKVMFEDDGTARTKLLMHLGFSLPAEE 471 >gb|PPE00146.1| hypothetical protein GOBAR_DD02799 [Gossypium barbadense] Length = 1123 Score = 59.3 bits (142), Expect = 3e-07 Identities = 28/35 (80%), Positives = 29/35 (82%) Frame = +3 Query: 87 DERGTWGHLKVMFEDDGTTRMKLLNHLGFSLLAEE 191 D+R TWG LKVMFEDDGT R KLL HLGFSL AEE Sbjct: 437 DDRETWGFLKVMFEDDGTARTKLLMHLGFSLPAEE 471 >gb|PPR80409.1| hypothetical protein GOBAR_AA40308 [Gossypium barbadense] Length = 1171 Score = 59.3 bits (142), Expect = 3e-07 Identities = 28/35 (80%), Positives = 29/35 (82%) Frame = +3 Query: 87 DERGTWGHLKVMFEDDGTTRMKLLNHLGFSLLAEE 191 D+R TWG LKVMFEDDGT R KLL HLGFSL AEE Sbjct: 486 DDRETWGFLKVMFEDDGTARTKLLMHLGFSLPAEE 520 >ref|XP_022018235.1| protein transport protein SEC31 homolog B-like isoform X3 [Helianthus annuus] Length = 939 Score = 58.5 bits (140), Expect = 6e-07 Identities = 27/38 (71%), Positives = 30/38 (78%) Frame = +3 Query: 87 DERGTWGHLKVMFEDDGTTRMKLLNHLGFSLLAEEVND 200 +E+ TWG LKVMFEDDGT R KLLNHLGF+L AE D Sbjct: 284 EEKETWGFLKVMFEDDGTARSKLLNHLGFTLPAEANED 321 >ref|XP_022770128.1| protein transport protein SEC31 homolog B-like isoform X2 [Durio zibethinus] Length = 942 Score = 58.5 bits (140), Expect = 6e-07 Identities = 27/35 (77%), Positives = 29/35 (82%) Frame = +3 Query: 87 DERGTWGHLKVMFEDDGTTRMKLLNHLGFSLLAEE 191 D+R TWG LKVMFEDDGT R KLL HLGFS+ AEE Sbjct: 437 DDRETWGFLKVMFEDDGTARTKLLMHLGFSVSAEE 471