BLASTX nr result
ID: Chrysanthemum21_contig00009600
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00009600 (685 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KVH90830.1| Zinc finger, AN1-type [Cynara cardunculus var. sc... 119 3e-30 ref|XP_023729765.1| zinc finger A20 and AN1 domain-containing st... 117 9e-30 gb|PLY76967.1| hypothetical protein LSAT_6X48240 [Lactuca sativa] 119 2e-29 gb|KVI09450.1| Zinc finger, AN1-type [Cynara cardunculus var. sc... 116 4e-29 ref|XP_023751481.1| zinc finger A20 and AN1 domain-containing st... 115 1e-28 gb|AMB19672.1| putative A20/AN1-like zinc finger family protein ... 115 1e-28 gb|ABS72032.1| putative AN1-like zinc finger protein, partial [O... 112 2e-28 ref|XP_009770817.1| PREDICTED: zinc finger A20 and AN1 domain-co... 114 2e-28 ref|XP_022001154.1| zinc finger A20 and AN1 domain-containing st... 116 2e-28 ref|XP_019237249.1| PREDICTED: zinc finger A20 and AN1 domain-co... 114 3e-28 ref|XP_022855145.1| zinc finger A20 and AN1 domain-containing st... 114 3e-28 ref|XP_022879030.1| zinc finger A20 and AN1 domain-containing st... 113 7e-28 ref|XP_022013634.1| zinc finger A20 and AN1 domain-containing st... 112 8e-28 gb|ACM68451.1| stress-associated protein 1, partial [Solanum pen... 110 9e-28 gb|AAR83854.1| induced stolon tip protein [Capsicum annuum] >gi|... 110 1e-27 ref|XP_019155416.1| PREDICTED: zinc finger A20 and AN1 domain-co... 112 1e-27 ref|XP_016494418.1| PREDICTED: zinc finger A20 and AN1 domain-co... 112 1e-27 ref|XP_009589288.1| PREDICTED: zinc finger A20 and AN1 domain-co... 112 1e-27 emb|CDP20562.1| unnamed protein product [Coffea canephora] 112 2e-27 gb|KHN29214.1| Zinc finger A20 and AN1 domain-containing stress-... 111 2e-27 >gb|KVH90830.1| Zinc finger, AN1-type [Cynara cardunculus var. scolymus] Length = 154 Score = 119 bits (297), Expect = 3e-30 Identities = 54/56 (96%), Positives = 55/56 (98%) Frame = -1 Query: 685 RRKVGLMGFRCRCGEMFCSDHRYSDRHDCSYDYKSVGREAIARENPVVRAAKILKV 518 RRKVGLMGFRCRCGEMFCSDHRYSDRHDCSYDYK+ GREAIARENPVVRAAKILKV Sbjct: 99 RRKVGLMGFRCRCGEMFCSDHRYSDRHDCSYDYKAAGREAIARENPVVRAAKILKV 154 >ref|XP_023729765.1| zinc finger A20 and AN1 domain-containing stress-associated protein 5-like [Lactuca sativa] Length = 154 Score = 117 bits (294), Expect = 9e-30 Identities = 53/56 (94%), Positives = 55/56 (98%) Frame = -1 Query: 685 RRKVGLMGFRCRCGEMFCSDHRYSDRHDCSYDYKSVGREAIARENPVVRAAKILKV 518 RRKVGLMGFRCRCGEMFCSDHRYSDRHDCSYDYK+ GREAIARENPVVRA+KILKV Sbjct: 99 RRKVGLMGFRCRCGEMFCSDHRYSDRHDCSYDYKAAGREAIARENPVVRASKILKV 154 >gb|PLY76967.1| hypothetical protein LSAT_6X48240 [Lactuca sativa] Length = 226 Score = 119 bits (297), Expect = 2e-29 Identities = 54/66 (81%), Positives = 59/66 (89%) Frame = -1 Query: 685 RRKVGLMGFRCRCGEMFCSDHRYSDRHDCSYDYKSVGREAIARENPVVRAAKILKV*KRT 506 RRKVGLMGFRCRCGEMFCSDHRYSDRHDCSYDYK+ GREAIARENPVVRA+KILK K Sbjct: 99 RRKVGLMGFRCRCGEMFCSDHRYSDRHDCSYDYKAAGREAIARENPVVRASKILKAGKYK 158 Query: 505 KTDENL 488 K ++ + Sbjct: 159 KMEKEI 164 >gb|KVI09450.1| Zinc finger, AN1-type [Cynara cardunculus var. scolymus] Length = 159 Score = 116 bits (290), Expect = 4e-29 Identities = 52/56 (92%), Positives = 55/56 (98%) Frame = -1 Query: 685 RRKVGLMGFRCRCGEMFCSDHRYSDRHDCSYDYKSVGREAIARENPVVRAAKILKV 518 +RKVGLMGFRCRCGEMFCS+HRYSDRHDCSYDYK+ GREAIARENPVVRAAKILKV Sbjct: 104 KRKVGLMGFRCRCGEMFCSEHRYSDRHDCSYDYKAAGREAIARENPVVRAAKILKV 159 >ref|XP_023751481.1| zinc finger A20 and AN1 domain-containing stress-associated protein 5-like [Lactuca sativa] gb|PLY94838.1| hypothetical protein LSAT_2X100821 [Lactuca sativa] Length = 155 Score = 115 bits (287), Expect = 1e-28 Identities = 51/56 (91%), Positives = 55/56 (98%) Frame = -1 Query: 685 RRKVGLMGFRCRCGEMFCSDHRYSDRHDCSYDYKSVGREAIARENPVVRAAKILKV 518 +RKVGLMGFRCRCGEMFCS+HRYSDRHDC+YDYK+ GREAIARENPVVRAAKILKV Sbjct: 100 KRKVGLMGFRCRCGEMFCSEHRYSDRHDCNYDYKAAGREAIARENPVVRAAKILKV 155 >gb|AMB19672.1| putative A20/AN1-like zinc finger family protein 1 [Taraxacum kok-saghyz] Length = 161 Score = 115 bits (287), Expect = 1e-28 Identities = 51/56 (91%), Positives = 55/56 (98%) Frame = -1 Query: 685 RRKVGLMGFRCRCGEMFCSDHRYSDRHDCSYDYKSVGREAIARENPVVRAAKILKV 518 +RKVGLMGFRCRCG+MFCS+HRYSDRHDCSYDYK+ GREAIARENPVVRAAKILKV Sbjct: 100 KRKVGLMGFRCRCGDMFCSEHRYSDRHDCSYDYKAAGREAIARENPVVRAAKILKV 155 >gb|ABS72032.1| putative AN1-like zinc finger protein, partial [Olea europaea] Length = 76 Score = 112 bits (279), Expect = 2e-28 Identities = 48/56 (85%), Positives = 55/56 (98%) Frame = -1 Query: 685 RRKVGLMGFRCRCGEMFCSDHRYSDRHDCSYDYKSVGREAIARENPVVRAAKILKV 518 R+K+GL+GFRCRCGEMFCS+HRYSDRHDC+YDYK+ GREAIARENPVV+AAKILKV Sbjct: 21 RKKIGLIGFRCRCGEMFCSEHRYSDRHDCNYDYKAAGREAIARENPVVKAAKILKV 76 >ref|XP_009770817.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated protein 5-like [Nicotiana sylvestris] Length = 151 Score = 114 bits (285), Expect = 2e-28 Identities = 51/56 (91%), Positives = 55/56 (98%) Frame = -1 Query: 685 RRKVGLMGFRCRCGEMFCSDHRYSDRHDCSYDYKSVGREAIARENPVVRAAKILKV 518 RRKVGL+GFRCRCGE+FCS+HRYSDRHDCSYDYK+ GREAIARENPVVRAAKILKV Sbjct: 96 RRKVGLIGFRCRCGEVFCSEHRYSDRHDCSYDYKAAGREAIARENPVVRAAKILKV 151 >ref|XP_022001154.1| zinc finger A20 and AN1 domain-containing stress-associated protein 5-like [Helianthus annuus] gb|OTG01627.1| putative zinc finger, AN1-type [Helianthus annuus] Length = 234 Score = 116 bits (291), Expect = 2e-28 Identities = 53/56 (94%), Positives = 54/56 (96%) Frame = -1 Query: 685 RRKVGLMGFRCRCGEMFCSDHRYSDRHDCSYDYKSVGREAIARENPVVRAAKILKV 518 RRKVGLMGFRCRCGE FCSDHRYSDRHDCSYDYK+ GREAIARENPVVRAAKILKV Sbjct: 179 RRKVGLMGFRCRCGETFCSDHRYSDRHDCSYDYKAAGREAIARENPVVRAAKILKV 234 >ref|XP_019237249.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated protein 5-like [Nicotiana attenuata] gb|OIT22548.1| zinc finger a20 and an1 domain-containing stress-associated protein 5 [Nicotiana attenuata] Length = 151 Score = 114 bits (284), Expect = 3e-28 Identities = 50/56 (89%), Positives = 55/56 (98%) Frame = -1 Query: 685 RRKVGLMGFRCRCGEMFCSDHRYSDRHDCSYDYKSVGREAIARENPVVRAAKILKV 518 RRK+GL+GFRCRCGE+FCS+HRYSDRHDCSYDYK+ GREAIARENPVVRAAKILKV Sbjct: 96 RRKIGLIGFRCRCGEVFCSEHRYSDRHDCSYDYKTAGREAIARENPVVRAAKILKV 151 >ref|XP_022855145.1| zinc finger A20 and AN1 domain-containing stress-associated protein 5-like [Olea europaea var. sylvestris] Length = 158 Score = 114 bits (284), Expect = 3e-28 Identities = 50/56 (89%), Positives = 55/56 (98%) Frame = -1 Query: 685 RRKVGLMGFRCRCGEMFCSDHRYSDRHDCSYDYKSVGREAIARENPVVRAAKILKV 518 R+K+GL+GFRCRCGE+FCS+HRYSDRHDCSYDYKS GREAIARENPVVRAAKILKV Sbjct: 103 RKKIGLIGFRCRCGEVFCSEHRYSDRHDCSYDYKSAGREAIARENPVVRAAKILKV 158 >ref|XP_022879030.1| zinc finger A20 and AN1 domain-containing stress-associated protein 5-like [Olea europaea var. sylvestris] Length = 160 Score = 113 bits (282), Expect = 7e-28 Identities = 49/56 (87%), Positives = 55/56 (98%) Frame = -1 Query: 685 RRKVGLMGFRCRCGEMFCSDHRYSDRHDCSYDYKSVGREAIARENPVVRAAKILKV 518 R+K+GL+GFRCRCGEMFCS+HRYSDRHDCSYDYK+ GREAIARENPVV+AAKILKV Sbjct: 105 RKKIGLIGFRCRCGEMFCSEHRYSDRHDCSYDYKAAGREAIARENPVVKAAKILKV 160 >ref|XP_022013634.1| zinc finger A20 and AN1 domain-containing stress-associated protein 5-like [Helianthus annuus] gb|OTG33635.1| putative zinc finger, AN1-type [Helianthus annuus] Length = 155 Score = 112 bits (281), Expect = 8e-28 Identities = 51/56 (91%), Positives = 55/56 (98%) Frame = -1 Query: 685 RRKVGLMGFRCRCGEMFCSDHRYSDRHDCSYDYKSVGREAIARENPVVRAAKILKV 518 +RKVGL+GFRCRCGEMFCS+HRYSDRH CSYDYK+VGREAIARENPVVRAAKILKV Sbjct: 100 KRKVGLIGFRCRCGEMFCSEHRYSDRHVCSYDYKAVGREAIARENPVVRAAKILKV 155 >gb|ACM68451.1| stress-associated protein 1, partial [Solanum pennellii] Length = 87 Score = 110 bits (275), Expect = 9e-28 Identities = 48/56 (85%), Positives = 53/56 (94%) Frame = -1 Query: 685 RRKVGLMGFRCRCGEMFCSDHRYSDRHDCSYDYKSVGREAIARENPVVRAAKILKV 518 RRKVGL GFRCRCGE+FC +HRYSDRHDCSYDYK+ GREAIARENPVV+AAKI+KV Sbjct: 32 RRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKTAGREAIARENPVVKAAKIIKV 87 >gb|AAR83854.1| induced stolon tip protein [Capsicum annuum] gb|PHT59116.1| Zinc finger A20 and AN1 domain-containing stress-associated protein 1 [Capsicum baccatum] gb|PHU30166.1| Zinc finger A20 and AN1 domain-containing stress-associated protein 1 [Capsicum chinense] Length = 88 Score = 110 bits (275), Expect = 1e-27 Identities = 48/56 (85%), Positives = 53/56 (94%) Frame = -1 Query: 685 RRKVGLMGFRCRCGEMFCSDHRYSDRHDCSYDYKSVGREAIARENPVVRAAKILKV 518 RRKVGL GFRCRCGE+FC +HRYSDRHDCSYDYK+ GREAIARENPVV+AAKI+KV Sbjct: 33 RRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKTAGREAIARENPVVKAAKIIKV 88 >ref|XP_019155416.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated protein 5-like [Ipomoea nil] Length = 139 Score = 112 bits (279), Expect = 1e-27 Identities = 50/56 (89%), Positives = 54/56 (96%) Frame = -1 Query: 685 RRKVGLMGFRCRCGEMFCSDHRYSDRHDCSYDYKSVGREAIARENPVVRAAKILKV 518 RRKVGL+GFRCRCGE+FCS HRYSDRHDCS+DYK+ GREAIARENPVVRAAKILKV Sbjct: 84 RRKVGLVGFRCRCGEVFCSQHRYSDRHDCSFDYKAAGREAIARENPVVRAAKILKV 139 >ref|XP_016494418.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated protein 5-like [Nicotiana tabacum] Length = 151 Score = 112 bits (279), Expect = 1e-27 Identities = 50/56 (89%), Positives = 55/56 (98%) Frame = -1 Query: 685 RRKVGLMGFRCRCGEMFCSDHRYSDRHDCSYDYKSVGREAIARENPVVRAAKILKV 518 RRKVGL+GFRCRCG++FCS+HRYSDRH CSYDYK+VGREAIARENPVVRAAKILKV Sbjct: 96 RRKVGLIGFRCRCGDVFCSEHRYSDRHGCSYDYKAVGREAIARENPVVRAAKILKV 151 >ref|XP_009589288.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated protein 5-like [Nicotiana tomentosiformis] Length = 151 Score = 112 bits (279), Expect = 1e-27 Identities = 50/56 (89%), Positives = 55/56 (98%) Frame = -1 Query: 685 RRKVGLMGFRCRCGEMFCSDHRYSDRHDCSYDYKSVGREAIARENPVVRAAKILKV 518 RRKVGL+GFRCRCG++FCS+HRYSDRH CSYDYK+VGREAIARENPVVRAAKILKV Sbjct: 96 RRKVGLIGFRCRCGDVFCSEHRYSDRHGCSYDYKAVGREAIARENPVVRAAKILKV 151 >emb|CDP20562.1| unnamed protein product [Coffea canephora] Length = 159 Score = 112 bits (279), Expect = 2e-27 Identities = 49/56 (87%), Positives = 54/56 (96%) Frame = -1 Query: 685 RRKVGLMGFRCRCGEMFCSDHRYSDRHDCSYDYKSVGREAIARENPVVRAAKILKV 518 RRK+GLMGFRCRCG+MFCS+HRYSDRHDCSYDYK+ GREAIARENPVV+A KILKV Sbjct: 104 RRKLGLMGFRCRCGDMFCSEHRYSDRHDCSYDYKTAGREAIARENPVVKAPKILKV 159 >gb|KHN29214.1| Zinc finger A20 and AN1 domain-containing stress-associated protein 5 [Glycine soja] Length = 136 Score = 111 bits (277), Expect = 2e-27 Identities = 48/56 (85%), Positives = 54/56 (96%) Frame = -1 Query: 685 RRKVGLMGFRCRCGEMFCSDHRYSDRHDCSYDYKSVGREAIARENPVVRAAKILKV 518 RRKVGL GFRCRCGE+FC++HRYSDRHDCSYDYK+ GREAIARENPV+RAAKI+KV Sbjct: 81 RRKVGLTGFRCRCGELFCAEHRYSDRHDCSYDYKAAGREAIARENPVIRAAKIVKV 136