BLASTX nr result
ID: Chrysanthemum21_contig00009561
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00009561 (578 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_022001394.1| uncharacterized protein LOC110898855 [Helian... 69 2e-10 ref|XP_022041387.1| hsp70 nucleotide exchange factor FES1-like [... 69 3e-10 ref|XP_016183753.1| hsp70 nucleotide exchange factor FES1 [Arach... 57 5e-06 >ref|XP_022001394.1| uncharacterized protein LOC110898855 [Helianthus annuus] gb|OTG01871.1| putative fes1B [Helianthus annuus] Length = 372 Score = 69.3 bits (168), Expect = 2e-10 Identities = 34/47 (72%), Positives = 39/47 (82%), Gaps = 1/47 (2%) Frame = +3 Query: 3 EKGLVVLPGDDTDDAPPDVASKMFESPLRGASRP-ANGDDKSKKKDA 140 EKGLVVLPGDD D+ PPDVAS++ SPLRG +RP AN DKS+KKDA Sbjct: 317 EKGLVVLPGDDVDELPPDVASRVLVSPLRGLNRPAANNGDKSEKKDA 363 >ref|XP_022041387.1| hsp70 nucleotide exchange factor FES1-like [Helianthus annuus] gb|OTG36049.1| putative fes1A [Helianthus annuus] Length = 369 Score = 68.9 bits (167), Expect = 3e-10 Identities = 34/46 (73%), Positives = 39/46 (84%), Gaps = 1/46 (2%) Frame = +3 Query: 3 EKGLVVLPGDDTDDAPPDVASKMFESPLRGASRP-ANGDDKSKKKD 137 EKGLVVLPGDD + PPDVASK+F SPLRG++RP AN DKS+KKD Sbjct: 317 EKGLVVLPGDDVVELPPDVASKLFVSPLRGSNRPTANNGDKSEKKD 362 >ref|XP_016183753.1| hsp70 nucleotide exchange factor FES1 [Arachis ipaensis] Length = 382 Score = 56.6 bits (135), Expect = 5e-06 Identities = 29/48 (60%), Positives = 35/48 (72%), Gaps = 2/48 (4%) Frame = +3 Query: 3 EKGLVVLPGDDTDDAPPDVASKMFESPLRGASRPANG--DDKSKKKDA 140 EKGL+VLPG+D APPDVASK FE PLR +S N + KS+KK+A Sbjct: 317 EKGLLVLPGEDNAAAPPDVASKFFEPPLRSSSANPNSKRESKSEKKEA 364