BLASTX nr result
ID: Chrysanthemum21_contig00009314
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00009314 (533 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KVI04805.1| G protein alpha subunit, helical insertion [Cynar... 56 6e-06 >gb|KVI04805.1| G protein alpha subunit, helical insertion [Cynara cardunculus var. scolymus] Length = 696 Score = 56.2 bits (134), Expect = 6e-06 Identities = 27/40 (67%), Positives = 31/40 (77%) Frame = -2 Query: 355 SNNDASTLLISSMALNYDHLGLQKIMLFGLEGSGTSTIFK 236 SNND ST L SM N +H +QK+MLFGLEGSGTST+FK Sbjct: 327 SNNDPSTFLSKSMPQNLEHGRVQKLMLFGLEGSGTSTVFK 366