BLASTX nr result
ID: Chrysanthemum21_contig00009059
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00009059 (485 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_008354991.2| PREDICTED: LOW QUALITY PROTEIN: calpain-type... 64 9e-09 ref|XP_016448912.1| PREDICTED: calpain-type cysteine protease DE... 61 9e-09 ref|XP_016448913.1| PREDICTED: calpain-type cysteine protease DE... 61 1e-08 ref|XP_009375947.1| PREDICTED: calpain-type cysteine protease DE... 63 2e-08 ref|XP_008384361.1| PREDICTED: calpain-type cysteine protease DE... 63 2e-08 ref|XP_017182251.1| PREDICTED: calpain-type cysteine protease DE... 63 2e-08 gb|PKI35356.1| hypothetical protein CRG98_044270 [Punica granatum] 61 3e-08 ref|XP_024198600.1| calpain-type cysteine protease DEK1 [Rosa ch... 62 3e-08 ref|XP_021816669.1| calpain-type cysteine protease DEK1 [Prunus ... 62 3e-08 ref|XP_008222910.1| PREDICTED: calpain-type cysteine protease DE... 62 3e-08 ref|XP_007208413.1| calpain-type cysteine protease DEK1 [Prunus ... 62 3e-08 ref|XP_009339183.1| PREDICTED: calpain-type cysteine protease DE... 62 3e-08 ref|XP_004294954.1| PREDICTED: calpain-type cysteine protease DE... 62 4e-08 ref|XP_022026510.1| calpain-type cysteine protease DEK1-like [He... 62 6e-08 gb|OTG35483.1| putative concanavalin A-like lectin/glucanase dom... 62 6e-08 gb|OWM69285.1| hypothetical protein CDL15_Pgr025472 [Punica gran... 61 8e-08 ref|XP_018837168.1| PREDICTED: calpain-type cysteine protease DE... 61 8e-08 dbj|GAU18739.1| hypothetical protein TSUD_80270 [Trifolium subte... 57 8e-08 gb|EOY31679.1| Calpain-type cysteine protease family isoform 4 [... 61 1e-07 ref|XP_009619217.1| PREDICTED: calpain-type cysteine protease DE... 61 1e-07 >ref|XP_008354991.2| PREDICTED: LOW QUALITY PROTEIN: calpain-type cysteine protease DEK1-like [Malus domestica] Length = 1952 Score = 63.9 bits (154), Expect = 9e-09 Identities = 29/51 (56%), Positives = 37/51 (72%), Gaps = 4/51 (7%) Frame = -1 Query: 434 LAKRSHGWGEDKK----LCINSGTLFSVLGSISFSILWVVNWRPWQIYRYI 294 + +R W D++ C+ SGTLFSVLGS SFSILW+VNWRPW+IY +I Sbjct: 4 VGERGKPWKGDERHLLLACVISGTLFSVLGSASFSILWLVNWRPWRIYSWI 54 >ref|XP_016448912.1| PREDICTED: calpain-type cysteine protease DEK1-like isoform X1 [Nicotiana tabacum] Length = 155 Score = 61.2 bits (147), Expect = 9e-09 Identities = 25/33 (75%), Positives = 29/33 (87%) Frame = -1 Query: 392 CINSGTLFSVLGSISFSILWVVNWRPWQIYRYI 294 C+ SGTLFSVLGS SF+ILW VNWRPW+IYR + Sbjct: 12 CVISGTLFSVLGSASFAILWAVNWRPWRIYRQL 44 >ref|XP_016448913.1| PREDICTED: calpain-type cysteine protease DEK1-like isoform X2 [Nicotiana tabacum] Length = 147 Score = 60.8 bits (146), Expect = 1e-08 Identities = 25/33 (75%), Positives = 29/33 (87%) Frame = -1 Query: 392 CINSGTLFSVLGSISFSILWVVNWRPWQIYRYI 294 C+ SGTLFSVLGS SF+ILW VNWRPW+IY +I Sbjct: 12 CVISGTLFSVLGSASFAILWAVNWRPWRIYSWI 44 >ref|XP_009375947.1| PREDICTED: calpain-type cysteine protease DEK1-like [Pyrus x bretschneideri] ref|XP_009375953.1| PREDICTED: calpain-type cysteine protease DEK1-like [Pyrus x bretschneideri] Length = 2160 Score = 62.8 bits (151), Expect = 2e-08 Identities = 28/42 (66%), Positives = 35/42 (83%), Gaps = 3/42 (7%) Frame = -1 Query: 410 GEDKKL---CINSGTLFSVLGSISFSILWVVNWRPWQIYRYI 294 G+++ L C+ SGTLFSVLGS SFSILW+VNWRPW+IY +I Sbjct: 3 GDERHLLLACVISGTLFSVLGSASFSILWLVNWRPWRIYSWI 44 >ref|XP_008384361.1| PREDICTED: calpain-type cysteine protease DEK1-like [Malus domestica] ref|XP_008384362.1| PREDICTED: calpain-type cysteine protease DEK1-like [Malus domestica] Length = 2160 Score = 62.8 bits (151), Expect = 2e-08 Identities = 28/42 (66%), Positives = 35/42 (83%), Gaps = 3/42 (7%) Frame = -1 Query: 410 GEDKKL---CINSGTLFSVLGSISFSILWVVNWRPWQIYRYI 294 G+++ L C+ SGTLFSVLGS SFSILW+VNWRPW+IY +I Sbjct: 3 GDERXLLLACVISGTLFSVLGSASFSILWLVNWRPWRIYSWI 44 >ref|XP_017182251.1| PREDICTED: calpain-type cysteine protease DEK1 [Malus domestica] Length = 2163 Score = 62.8 bits (151), Expect = 2e-08 Identities = 28/42 (66%), Positives = 35/42 (83%), Gaps = 3/42 (7%) Frame = -1 Query: 410 GEDKKL---CINSGTLFSVLGSISFSILWVVNWRPWQIYRYI 294 G+++ L C+ SGTLFSVLGS SFSILW+VNWRPW+IY +I Sbjct: 3 GDERHLLLACVISGTLFSVLGSASFSILWLVNWRPWRIYSWI 44 >gb|PKI35356.1| hypothetical protein CRG98_044270 [Punica granatum] Length = 231 Score = 61.2 bits (147), Expect = 3e-08 Identities = 27/42 (64%), Positives = 34/42 (80%), Gaps = 3/42 (7%) Frame = -1 Query: 410 GEDKKL---CINSGTLFSVLGSISFSILWVVNWRPWQIYRYI 294 G++K L C+ SGTLF++LGS SFSILW VNWRPW+IY +I Sbjct: 3 GDEKNLVLACVISGTLFAILGSGSFSILWAVNWRPWRIYSWI 44 >ref|XP_024198600.1| calpain-type cysteine protease DEK1 [Rosa chinensis] gb|PRQ35792.1| putative calpain-3 protein [Rosa chinensis] Length = 2149 Score = 62.4 bits (150), Expect = 3e-08 Identities = 26/33 (78%), Positives = 30/33 (90%) Frame = -1 Query: 392 CINSGTLFSVLGSISFSILWVVNWRPWQIYRYI 294 C+ SGTLFSVLGS SFSILW+VNWRPW+IY +I Sbjct: 12 CVISGTLFSVLGSASFSILWLVNWRPWRIYSWI 44 >ref|XP_021816669.1| calpain-type cysteine protease DEK1 [Prunus avium] ref|XP_021816670.1| calpain-type cysteine protease DEK1 [Prunus avium] Length = 2160 Score = 62.4 bits (150), Expect = 3e-08 Identities = 26/33 (78%), Positives = 30/33 (90%) Frame = -1 Query: 392 CINSGTLFSVLGSISFSILWVVNWRPWQIYRYI 294 C+ SGTLFSVLGS SFSILW+VNWRPW+IY +I Sbjct: 12 CVISGTLFSVLGSASFSILWLVNWRPWRIYSWI 44 >ref|XP_008222910.1| PREDICTED: calpain-type cysteine protease DEK1 [Prunus mume] Length = 2160 Score = 62.4 bits (150), Expect = 3e-08 Identities = 26/33 (78%), Positives = 30/33 (90%) Frame = -1 Query: 392 CINSGTLFSVLGSISFSILWVVNWRPWQIYRYI 294 C+ SGTLFSVLGS SFSILW+VNWRPW+IY +I Sbjct: 12 CVISGTLFSVLGSASFSILWLVNWRPWRIYSWI 44 >ref|XP_007208413.1| calpain-type cysteine protease DEK1 [Prunus persica] ref|XP_020421110.1| calpain-type cysteine protease DEK1 [Prunus persica] gb|ONH98985.1| hypothetical protein PRUPE_6G003300 [Prunus persica] gb|ONH98986.1| hypothetical protein PRUPE_6G003300 [Prunus persica] Length = 2160 Score = 62.4 bits (150), Expect = 3e-08 Identities = 26/33 (78%), Positives = 30/33 (90%) Frame = -1 Query: 392 CINSGTLFSVLGSISFSILWVVNWRPWQIYRYI 294 C+ SGTLFSVLGS SFSILW+VNWRPW+IY +I Sbjct: 12 CVISGTLFSVLGSASFSILWLVNWRPWRIYSWI 44 >ref|XP_009339183.1| PREDICTED: calpain-type cysteine protease DEK1-like [Pyrus x bretschneideri] ref|XP_009339184.1| PREDICTED: calpain-type cysteine protease DEK1-like [Pyrus x bretschneideri] Length = 2171 Score = 62.4 bits (150), Expect = 3e-08 Identities = 26/33 (78%), Positives = 30/33 (90%) Frame = -1 Query: 392 CINSGTLFSVLGSISFSILWVVNWRPWQIYRYI 294 C+ SGTLFSVLGS SFSILW+VNWRPW+IY +I Sbjct: 23 CVISGTLFSVLGSASFSILWLVNWRPWRIYSWI 55 >ref|XP_004294954.1| PREDICTED: calpain-type cysteine protease DEK1 [Fragaria vesca subsp. vesca] Length = 2161 Score = 62.0 bits (149), Expect = 4e-08 Identities = 26/33 (78%), Positives = 30/33 (90%) Frame = -1 Query: 392 CINSGTLFSVLGSISFSILWVVNWRPWQIYRYI 294 C+ SGTLFSVLGS SFSILW+VNWRPW+IY +I Sbjct: 12 CLISGTLFSVLGSASFSILWLVNWRPWRIYSWI 44 >ref|XP_022026510.1| calpain-type cysteine protease DEK1-like [Helianthus annuus] Length = 2139 Score = 61.6 bits (148), Expect = 6e-08 Identities = 27/42 (64%), Positives = 34/42 (80%), Gaps = 3/42 (7%) Frame = -1 Query: 410 GEDKKL---CINSGTLFSVLGSISFSILWVVNWRPWQIYRYI 294 GED K+ C+ SGT+F+VLGS SF+ILW VNWRPW+IY +I Sbjct: 3 GEDTKVMLACVISGTVFAVLGSASFAILWAVNWRPWRIYSWI 44 >gb|OTG35483.1| putative concanavalin A-like lectin/glucanase domain, Peptidase C2, calpain family [Helianthus annuus] Length = 2155 Score = 61.6 bits (148), Expect = 6e-08 Identities = 27/42 (64%), Positives = 34/42 (80%), Gaps = 3/42 (7%) Frame = -1 Query: 410 GEDKKL---CINSGTLFSVLGSISFSILWVVNWRPWQIYRYI 294 GED K+ C+ SGT+F+VLGS SF+ILW VNWRPW+IY +I Sbjct: 19 GEDTKVMLACVISGTVFAVLGSASFAILWAVNWRPWRIYSWI 60 >gb|OWM69285.1| hypothetical protein CDL15_Pgr025472 [Punica granatum] Length = 2153 Score = 61.2 bits (147), Expect = 8e-08 Identities = 27/42 (64%), Positives = 34/42 (80%), Gaps = 3/42 (7%) Frame = -1 Query: 410 GEDKKL---CINSGTLFSVLGSISFSILWVVNWRPWQIYRYI 294 G++K L C+ SGTLF++LGS SFSILW VNWRPW+IY +I Sbjct: 3 GDEKNLVLACVISGTLFAILGSGSFSILWAVNWRPWRIYSWI 44 >ref|XP_018837168.1| PREDICTED: calpain-type cysteine protease DEK1 [Juglans regia] ref|XP_018837175.1| PREDICTED: calpain-type cysteine protease DEK1 [Juglans regia] Length = 2158 Score = 61.2 bits (147), Expect = 8e-08 Identities = 26/33 (78%), Positives = 29/33 (87%) Frame = -1 Query: 392 CINSGTLFSVLGSISFSILWVVNWRPWQIYRYI 294 CI SGTLF+VLGS SFSILW VNWRPW+IY +I Sbjct: 12 CIISGTLFTVLGSASFSILWAVNWRPWRIYSWI 44 >dbj|GAU18739.1| hypothetical protein TSUD_80270 [Trifolium subterraneum] Length = 71 Score = 56.6 bits (135), Expect = 8e-08 Identities = 25/40 (62%), Positives = 29/40 (72%) Frame = -1 Query: 392 CINSGTLFSVLGSISFSILWVVNWRPWQIYRYITELSLVR 273 C GTLFSVLG SFSILW VNWRPW+IYR ++ V+ Sbjct: 14 CAICGTLFSVLGFSSFSILWAVNWRPWRIYRCTVVIASVK 53 >gb|EOY31679.1| Calpain-type cysteine protease family isoform 4 [Theobroma cacao] Length = 1936 Score = 60.8 bits (146), Expect = 1e-07 Identities = 25/33 (75%), Positives = 29/33 (87%) Frame = -1 Query: 392 CINSGTLFSVLGSISFSILWVVNWRPWQIYRYI 294 C+ SGTLF+VLGS SFSILW VNWRPW+IY +I Sbjct: 10 CVISGTLFAVLGSASFSILWAVNWRPWRIYSWI 42 >ref|XP_009619217.1| PREDICTED: calpain-type cysteine protease DEK1, partial [Nicotiana tomentosiformis] Length = 1964 Score = 60.8 bits (146), Expect = 1e-07 Identities = 25/33 (75%), Positives = 29/33 (87%) Frame = -1 Query: 392 CINSGTLFSVLGSISFSILWVVNWRPWQIYRYI 294 C+ SGTLFSVLGS SF+ILW VNWRPW+IY +I Sbjct: 12 CVISGTLFSVLGSASFAILWAVNWRPWRIYSWI 44