BLASTX nr result
ID: Chrysanthemum21_contig00008956
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00008956 (641 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_022036212.1| protein STRICTOSIDINE SYNTHASE-LIKE 4-like [... 58 3e-06 >ref|XP_022036212.1| protein STRICTOSIDINE SYNTHASE-LIKE 4-like [Helianthus annuus] ref|XP_022036213.1| protein STRICTOSIDINE SYNTHASE-LIKE 4-like [Helianthus annuus] gb|OTG29784.1| putative strictosidine synthase [Helianthus annuus] Length = 361 Score = 57.8 bits (138), Expect = 3e-06 Identities = 26/37 (70%), Positives = 33/37 (89%) Frame = -3 Query: 123 MGYGIITAIFLLVSAVVLTVQVFLYSPISPDILELPP 13 M +G+ITA F+LVSA+ +T+QVF +SPISPDILELPP Sbjct: 1 MEFGVITASFVLVSALAVTLQVFFFSPISPDILELPP 37