BLASTX nr result
ID: Chrysanthemum21_contig00008866
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00008866 (375 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KVH99597.1| Exocyst complex component Sec6 [Cynara cardunculu... 74 9e-13 ref|XP_021987184.1| exocyst complex component SEC6 [Helianthus a... 74 9e-13 gb|OTG09648.1| putative SEC6 [Helianthus annuus] 74 9e-13 ref|XP_021987183.1| exocyst complex component SEC6-like [Heliant... 68 9e-11 ref|XP_023766286.1| exocyst complex component SEC6 [Lactuca sati... 65 8e-10 ref|XP_019175325.1| PREDICTED: exocyst complex component SEC6 is... 64 2e-09 ref|XP_019175324.1| PREDICTED: exocyst complex component SEC6 is... 64 2e-09 ref|XP_022040533.1| exocyst complex component SEC6-like isoform ... 62 1e-08 ref|XP_022040519.1| exocyst complex component SEC6-like isoform ... 62 1e-08 ref|XP_022040515.1| exocyst complex component SEC6-like isoform ... 62 1e-08 ref|XP_022040510.1| exocyst complex component SEC6-like isoform ... 62 1e-08 gb|OTG35931.1| putative exocyst complex component Sec6 [Helianth... 62 1e-08 gb|EPS58419.1| hypothetical protein M569_16396 [Genlisea aurea] 56 5e-08 gb|ABY60778.1| exocyst complex subunit SEC6, partial [Carica pap... 55 8e-08 ref|XP_022879096.1| exocyst complex component SEC6 [Olea europae... 59 2e-07 ref|XP_020536150.1| exocyst complex component SEC6-like [Jatroph... 55 6e-07 ref|XP_011098272.1| exocyst complex component SEC6 [Sesamum indi... 57 7e-07 ref|XP_010063803.1| PREDICTED: exocyst complex component SEC6 is... 56 2e-06 gb|KCW71058.1| hypothetical protein EUGRSUZ_F04156 [Eucalyptus g... 56 2e-06 gb|KZV28935.1| hypothetical protein F511_13730 [Dorcoceras hygro... 56 2e-06 >gb|KVH99597.1| Exocyst complex component Sec6 [Cynara cardunculus var. scolymus] Length = 640 Score = 73.9 bits (180), Expect = 9e-13 Identities = 35/38 (92%), Positives = 37/38 (97%) Frame = -1 Query: 375 EIFENSLIDGNPPRAGFVFSKLKSLNTSKITNIWRKLH 262 EI+ENSLIDGNPPRAGFVFSKLKSL TSKITNI+RKLH Sbjct: 603 EIYENSLIDGNPPRAGFVFSKLKSLTTSKITNIFRKLH 640 >ref|XP_021987184.1| exocyst complex component SEC6 [Helianthus annuus] Length = 756 Score = 73.9 bits (180), Expect = 9e-13 Identities = 35/38 (92%), Positives = 37/38 (97%) Frame = -1 Query: 375 EIFENSLIDGNPPRAGFVFSKLKSLNTSKITNIWRKLH 262 EI+ENSLIDGNPP+AGFVFSKLKSLNTSKITNI RKLH Sbjct: 719 EIYENSLIDGNPPKAGFVFSKLKSLNTSKITNILRKLH 756 >gb|OTG09648.1| putative SEC6 [Helianthus annuus] Length = 830 Score = 73.9 bits (180), Expect = 9e-13 Identities = 35/38 (92%), Positives = 37/38 (97%) Frame = -1 Query: 375 EIFENSLIDGNPPRAGFVFSKLKSLNTSKITNIWRKLH 262 EI+ENSLIDGNPP+AGFVFSKLKSLNTSKITNI RKLH Sbjct: 793 EIYENSLIDGNPPKAGFVFSKLKSLNTSKITNILRKLH 830 >ref|XP_021987183.1| exocyst complex component SEC6-like [Helianthus annuus] gb|OTG09646.1| putative exocyst complex component Sec6 [Helianthus annuus] Length = 748 Score = 68.2 bits (165), Expect = 9e-11 Identities = 33/38 (86%), Positives = 36/38 (94%) Frame = -1 Query: 375 EIFENSLIDGNPPRAGFVFSKLKSLNTSKITNIWRKLH 262 EI+E+SLIDG P RAGFVFSKLKSLNTSKITNI+RKLH Sbjct: 711 EIYESSLIDGYPSRAGFVFSKLKSLNTSKITNIFRKLH 748 >ref|XP_023766286.1| exocyst complex component SEC6 [Lactuca sativa] gb|PLY83609.1| hypothetical protein LSAT_6X100921 [Lactuca sativa] Length = 756 Score = 65.5 bits (158), Expect = 8e-10 Identities = 31/38 (81%), Positives = 34/38 (89%) Frame = -1 Query: 375 EIFENSLIDGNPPRAGFVFSKLKSLNTSKITNIWRKLH 262 EI+ENSLIDGNPPR+GFVFSKLKSL S I NI+RKLH Sbjct: 719 EIYENSLIDGNPPRSGFVFSKLKSLKASGIGNIFRKLH 756 >ref|XP_019175325.1| PREDICTED: exocyst complex component SEC6 isoform X2 [Ipomoea nil] Length = 722 Score = 64.3 bits (155), Expect = 2e-09 Identities = 27/37 (72%), Positives = 35/37 (94%) Frame = -1 Query: 375 EIFENSLIDGNPPRAGFVFSKLKSLNTSKITNIWRKL 265 EI+ENSLIDGNPP+AGFVF ++KSL+ SK++N+WRKL Sbjct: 685 EIYENSLIDGNPPKAGFVFPRVKSLSHSKVSNLWRKL 721 >ref|XP_019175324.1| PREDICTED: exocyst complex component SEC6 isoform X1 [Ipomoea nil] Length = 753 Score = 64.3 bits (155), Expect = 2e-09 Identities = 27/37 (72%), Positives = 35/37 (94%) Frame = -1 Query: 375 EIFENSLIDGNPPRAGFVFSKLKSLNTSKITNIWRKL 265 EI+ENSLIDGNPP+AGFVF ++KSL+ SK++N+WRKL Sbjct: 716 EIYENSLIDGNPPKAGFVFPRVKSLSHSKVSNLWRKL 752 >ref|XP_022040533.1| exocyst complex component SEC6-like isoform X6 [Helianthus annuus] Length = 644 Score = 62.4 bits (150), Expect = 1e-08 Identities = 33/39 (84%), Positives = 34/39 (87%), Gaps = 1/39 (2%) Frame = -1 Query: 375 EIFENSLIDGNPPRAGFVFSKLKSLNTSKITNIW-RKLH 262 EI+ENSLIDGNPPRAGFVFSKLKSL TS NIW RKLH Sbjct: 609 EIYENSLIDGNPPRAGFVFSKLKSLTTS---NIWRRKLH 644 >ref|XP_022040519.1| exocyst complex component SEC6-like isoform X3 [Helianthus annuus] Length = 762 Score = 62.4 bits (150), Expect = 1e-08 Identities = 33/39 (84%), Positives = 34/39 (87%), Gaps = 1/39 (2%) Frame = -1 Query: 375 EIFENSLIDGNPPRAGFVFSKLKSLNTSKITNIW-RKLH 262 EI+ENSLIDGNPPRAGFVFSKLKSL TS NIW RKLH Sbjct: 727 EIYENSLIDGNPPRAGFVFSKLKSLTTS---NIWRRKLH 762 >ref|XP_022040515.1| exocyst complex component SEC6-like isoform X2 [Helianthus annuus] Length = 762 Score = 62.4 bits (150), Expect = 1e-08 Identities = 33/39 (84%), Positives = 34/39 (87%), Gaps = 1/39 (2%) Frame = -1 Query: 375 EIFENSLIDGNPPRAGFVFSKLKSLNTSKITNIW-RKLH 262 EI+ENSLIDGNPPRAGFVFSKLKSL TS NIW RKLH Sbjct: 727 EIYENSLIDGNPPRAGFVFSKLKSLTTS---NIWRRKLH 762 >ref|XP_022040510.1| exocyst complex component SEC6-like isoform X1 [Helianthus annuus] Length = 766 Score = 62.4 bits (150), Expect = 1e-08 Identities = 33/39 (84%), Positives = 34/39 (87%), Gaps = 1/39 (2%) Frame = -1 Query: 375 EIFENSLIDGNPPRAGFVFSKLKSLNTSKITNIW-RKLH 262 EI+ENSLIDGNPPRAGFVFSKLKSL TS NIW RKLH Sbjct: 731 EIYENSLIDGNPPRAGFVFSKLKSLTTS---NIWRRKLH 766 >gb|OTG35931.1| putative exocyst complex component Sec6 [Helianthus annuus] Length = 811 Score = 62.4 bits (150), Expect = 1e-08 Identities = 33/39 (84%), Positives = 34/39 (87%), Gaps = 1/39 (2%) Frame = -1 Query: 375 EIFENSLIDGNPPRAGFVFSKLKSLNTSKITNIW-RKLH 262 EI+ENSLIDGNPPRAGFVFSKLKSL TS NIW RKLH Sbjct: 776 EIYENSLIDGNPPRAGFVFSKLKSLTTS---NIWRRKLH 811 >gb|EPS58419.1| hypothetical protein M569_16396 [Genlisea aurea] Length = 56 Score = 55.8 bits (133), Expect = 5e-08 Identities = 23/37 (62%), Positives = 30/37 (81%) Frame = -1 Query: 375 EIFENSLIDGNPPRAGFVFSKLKSLNTSKITNIWRKL 265 EI+ENSL+DGNPP+AGFVF +KSL+ + +WRKL Sbjct: 19 EIYENSLVDGNPPKAGFVFPNVKSLSATSKNRLWRKL 55 >gb|ABY60778.1| exocyst complex subunit SEC6, partial [Carica papaya] gb|ABY60782.1| exocyst complex subunit SEC6, partial [Carica papaya] Length = 64 Score = 55.5 bits (132), Expect = 8e-08 Identities = 25/37 (67%), Positives = 32/37 (86%) Frame = -1 Query: 375 EIFENSLIDGNPPRAGFVFSKLKSLNTSKITNIWRKL 265 EI+ENSL+DGNPP+ GFVF K+KSL+ SK ++WRKL Sbjct: 28 EIYENSLVDGNPPKTGFVFPKVKSLSASK-GSLWRKL 63 >ref|XP_022879096.1| exocyst complex component SEC6 [Olea europaea var. sylvestris] Length = 756 Score = 58.5 bits (140), Expect = 2e-07 Identities = 27/37 (72%), Positives = 33/37 (89%) Frame = -1 Query: 375 EIFENSLIDGNPPRAGFVFSKLKSLNTSKITNIWRKL 265 EI+ENSL+DGNPP+AGFVF K+KSL+ SK T +WRKL Sbjct: 720 EIYENSLVDGNPPKAGFVFPKVKSLSASK-TPLWRKL 755 >ref|XP_020536150.1| exocyst complex component SEC6-like [Jatropha curcas] Length = 121 Score = 54.7 bits (130), Expect = 6e-07 Identities = 25/37 (67%), Positives = 30/37 (81%) Frame = -1 Query: 375 EIFENSLIDGNPPRAGFVFSKLKSLNTSKITNIWRKL 265 EI+ENSL+ GNPPR GFVFSK+KSL +K+ WRKL Sbjct: 86 EIYENSLVGGNPPRTGFVFSKVKSLQATKV--FWRKL 120 >ref|XP_011098272.1| exocyst complex component SEC6 [Sesamum indicum] Length = 755 Score = 57.0 bits (136), Expect = 7e-07 Identities = 24/37 (64%), Positives = 30/37 (81%) Frame = -1 Query: 375 EIFENSLIDGNPPRAGFVFSKLKSLNTSKITNIWRKL 265 EI+ENSL+DG PP+ GFVF K+KSL+ SK +WRKL Sbjct: 718 EIYENSLVDGQPPKTGFVFPKVKSLSASKHNRLWRKL 754 >ref|XP_010063803.1| PREDICTED: exocyst complex component SEC6 isoform X2 [Eucalyptus grandis] Length = 611 Score = 55.8 bits (133), Expect = 2e-06 Identities = 25/37 (67%), Positives = 33/37 (89%) Frame = -1 Query: 375 EIFENSLIDGNPPRAGFVFSKLKSLNTSKITNIWRKL 265 EI+ENSL+DGNPP+AGF+F K+KSL+ SK ++WRKL Sbjct: 575 EIYENSLVDGNPPKAGFLFPKVKSLSASK-GSLWRKL 610 >gb|KCW71058.1| hypothetical protein EUGRSUZ_F04156 [Eucalyptus grandis] Length = 732 Score = 55.8 bits (133), Expect = 2e-06 Identities = 25/37 (67%), Positives = 33/37 (89%) Frame = -1 Query: 375 EIFENSLIDGNPPRAGFVFSKLKSLNTSKITNIWRKL 265 EI+ENSL+DGNPP+AGF+F K+KSL+ SK ++WRKL Sbjct: 696 EIYENSLVDGNPPKAGFLFPKVKSLSASK-GSLWRKL 731 >gb|KZV28935.1| hypothetical protein F511_13730 [Dorcoceras hygrometricum] Length = 756 Score = 55.8 bits (133), Expect = 2e-06 Identities = 24/37 (64%), Positives = 32/37 (86%) Frame = -1 Query: 375 EIFENSLIDGNPPRAGFVFSKLKSLNTSKITNIWRKL 265 EI+ENSL+DGNPP+ GFVF ++K LN +K T++WRKL Sbjct: 720 EIYENSLVDGNPPKGGFVFPRVKCLNAAK-TSLWRKL 755