BLASTX nr result
ID: Chrysanthemum21_contig00008563
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00008563 (407 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS73061.1| hypothetical protein M569_01689 [Genlisea aurea] 80 9e-15 ref|XP_022027849.1| conserved oligomeric Golgi complex subunit 6... 79 2e-14 ref|XP_019153260.1| PREDICTED: conserved oligomeric Golgi comple... 79 3e-14 ref|XP_011082194.1| conserved oligomeric Golgi complex subunit 6... 78 4e-14 gb|KVI01676.1| Conserved oligomeric Golgi complex subunit 6 [Cyn... 77 7e-14 gb|PIN02092.1| hypothetical protein CDL12_25399 [Handroanthus im... 75 9e-14 ref|XP_022855496.1| conserved oligomeric Golgi complex subunit 6... 75 3e-13 ref|XP_022866697.1| conserved oligomeric Golgi complex subunit 6... 75 4e-13 ref|XP_023763515.1| conserved oligomeric Golgi complex subunit 6... 75 4e-13 ref|XP_012837388.1| PREDICTED: conserved oligomeric Golgi comple... 75 5e-13 ref|XP_017229882.1| PREDICTED: conserved oligomeric Golgi comple... 74 9e-13 gb|POF22987.1| conserved oligomeric golgi complex subunit 6 [Que... 69 2e-12 ref|XP_023880599.1| conserved oligomeric Golgi complex subunit 6... 72 4e-12 ref|XP_016201313.1| conserved oligomeric Golgi complex subunit 6... 72 4e-12 ref|XP_015963463.1| conserved oligomeric Golgi complex subunit 6... 72 4e-12 dbj|GAV71124.1| COG6 domain-containing protein [Cephalotus folli... 72 6e-12 ref|XP_019259871.1| PREDICTED: conserved oligomeric Golgi comple... 72 6e-12 ref|XP_009793211.1| PREDICTED: conserved oligomeric Golgi comple... 72 6e-12 ref|XP_009592302.1| PREDICTED: conserved oligomeric Golgi comple... 72 6e-12 ref|XP_021594892.1| conserved oligomeric Golgi complex subunit 6... 72 8e-12 >gb|EPS73061.1| hypothetical protein M569_01689 [Genlisea aurea] Length = 703 Score = 80.1 bits (196), Expect = 9e-15 Identities = 39/42 (92%), Positives = 41/42 (97%) Frame = -2 Query: 127 MGSTTALAPGLSRKLKKVLETRTDTPDLLSSLNTLSSFYTEN 2 MG+TTALAPGLSRKLKKVL+TRTDTPDLLSSLNTLS FYTEN Sbjct: 1 MGTTTALAPGLSRKLKKVLDTRTDTPDLLSSLNTLSKFYTEN 42 >ref|XP_022027849.1| conserved oligomeric Golgi complex subunit 6 [Helianthus annuus] gb|OTG30772.1| putative conserved oligomeric complex COG6 protein [Helianthus annuus] Length = 688 Score = 79.0 bits (193), Expect = 2e-14 Identities = 38/42 (90%), Positives = 42/42 (100%) Frame = -2 Query: 127 MGSTTALAPGLSRKLKKVLETRTDTPDLLSSLNTLSSFYTEN 2 MG+TTALAPGLSRKLKKVLETRTD+PDLL+SLNTLS+FYTEN Sbjct: 1 MGTTTALAPGLSRKLKKVLETRTDSPDLLASLNTLSTFYTEN 42 >ref|XP_019153260.1| PREDICTED: conserved oligomeric Golgi complex subunit 6 [Ipomoea nil] Length = 695 Score = 78.6 bits (192), Expect = 3e-14 Identities = 38/42 (90%), Positives = 41/42 (97%) Frame = -2 Query: 127 MGSTTALAPGLSRKLKKVLETRTDTPDLLSSLNTLSSFYTEN 2 MG+ TALAPGLSRKLKKVLETRTDTPDLL+SLNTLS+FYTEN Sbjct: 1 MGTATALAPGLSRKLKKVLETRTDTPDLLASLNTLSTFYTEN 42 >ref|XP_011082194.1| conserved oligomeric Golgi complex subunit 6 [Sesamum indicum] Length = 696 Score = 78.2 bits (191), Expect = 4e-14 Identities = 38/42 (90%), Positives = 41/42 (97%) Frame = -2 Query: 127 MGSTTALAPGLSRKLKKVLETRTDTPDLLSSLNTLSSFYTEN 2 MG+ TALAPGLSRKLKKVLETRTDTPDLL+SLNTLSSFY+EN Sbjct: 1 MGTATALAPGLSRKLKKVLETRTDTPDLLASLNTLSSFYSEN 42 >gb|KVI01676.1| Conserved oligomeric Golgi complex subunit 6 [Cynara cardunculus var. scolymus] Length = 625 Score = 77.4 bits (189), Expect = 7e-14 Identities = 37/42 (88%), Positives = 41/42 (97%) Frame = -2 Query: 127 MGSTTALAPGLSRKLKKVLETRTDTPDLLSSLNTLSSFYTEN 2 MG+TTALAPGLSRKLKKVLETRTD PDLL+SLNTLS+FYT+N Sbjct: 1 MGTTTALAPGLSRKLKKVLETRTDNPDLLASLNTLSTFYTDN 42 >gb|PIN02092.1| hypothetical protein CDL12_25399 [Handroanthus impetiginosus] Length = 228 Score = 75.1 bits (183), Expect = 9e-14 Identities = 36/42 (85%), Positives = 40/42 (95%) Frame = -2 Query: 127 MGSTTALAPGLSRKLKKVLETRTDTPDLLSSLNTLSSFYTEN 2 MG+ ALAPGLSRKLKKVL+TRTDTPDLL+SLNTLSSFY+EN Sbjct: 1 MGTAAALAPGLSRKLKKVLDTRTDTPDLLASLNTLSSFYSEN 42 >ref|XP_022855496.1| conserved oligomeric Golgi complex subunit 6-like isoform X1 [Olea europaea var. sylvestris] Length = 593 Score = 75.5 bits (184), Expect = 3e-13 Identities = 37/42 (88%), Positives = 40/42 (95%) Frame = -2 Query: 127 MGSTTALAPGLSRKLKKVLETRTDTPDLLSSLNTLSSFYTEN 2 MG+ TALAPGLSRKLKKVLETRTD PDLL+SLNTLSSFYT+N Sbjct: 1 MGTFTALAPGLSRKLKKVLETRTDIPDLLASLNTLSSFYTDN 42 >ref|XP_022866697.1| conserved oligomeric Golgi complex subunit 6-like [Olea europaea var. sylvestris] Length = 696 Score = 75.5 bits (184), Expect = 4e-13 Identities = 36/42 (85%), Positives = 40/42 (95%) Frame = -2 Query: 127 MGSTTALAPGLSRKLKKVLETRTDTPDLLSSLNTLSSFYTEN 2 MG++T LAPGLSRKLKKVLETRTD PDLL+SLNTLSSFYT+N Sbjct: 1 MGTSTVLAPGLSRKLKKVLETRTDNPDLLASLNTLSSFYTDN 42 >ref|XP_023763515.1| conserved oligomeric Golgi complex subunit 6 [Lactuca sativa] gb|PLY85703.1| hypothetical protein LSAT_9X124460 [Lactuca sativa] Length = 703 Score = 75.5 bits (184), Expect = 4e-13 Identities = 36/42 (85%), Positives = 40/42 (95%) Frame = -2 Query: 127 MGSTTALAPGLSRKLKKVLETRTDTPDLLSSLNTLSSFYTEN 2 MG+TTALAPGLSRKLKKVLETRTD PDLL+SLNTLS+FY +N Sbjct: 1 MGTTTALAPGLSRKLKKVLETRTDNPDLLASLNTLSTFYNDN 42 >ref|XP_012837388.1| PREDICTED: conserved oligomeric Golgi complex subunit 6 [Erythranthe guttata] gb|EYU37491.1| hypothetical protein MIMGU_mgv1a002271mg [Erythranthe guttata] Length = 692 Score = 75.1 bits (183), Expect = 5e-13 Identities = 36/42 (85%), Positives = 40/42 (95%) Frame = -2 Query: 127 MGSTTALAPGLSRKLKKVLETRTDTPDLLSSLNTLSSFYTEN 2 MG+ TALAPGLSRKLKKVLETRTD PDLL+SLNTLSSFY++N Sbjct: 1 MGTATALAPGLSRKLKKVLETRTDAPDLLASLNTLSSFYSDN 42 >ref|XP_017229882.1| PREDICTED: conserved oligomeric Golgi complex subunit 6 [Daucus carota subsp. sativus] gb|KZN08827.1| hypothetical protein DCAR_001483 [Daucus carota subsp. sativus] Length = 687 Score = 74.3 bits (181), Expect = 9e-13 Identities = 36/39 (92%), Positives = 38/39 (97%) Frame = -2 Query: 118 TTALAPGLSRKLKKVLETRTDTPDLLSSLNTLSSFYTEN 2 TT LAPGLSRKLKKVLETRTDTPDLL+SLNTLSSFYT+N Sbjct: 2 TTVLAPGLSRKLKKVLETRTDTPDLLASLNTLSSFYTDN 40 >gb|POF22987.1| conserved oligomeric golgi complex subunit 6 [Quercus suber] Length = 127 Score = 69.3 bits (168), Expect = 2e-12 Identities = 35/40 (87%), Positives = 36/40 (90%) Frame = -2 Query: 121 STTALAPGLSRKLKKVLETRTDTPDLLSSLNTLSSFYTEN 2 ST LAPGLSRKLKKVLE TD+PDLLSSLNTLSSFYTEN Sbjct: 4 STVGLAPGLSRKLKKVLECFTDSPDLLSSLNTLSSFYTEN 43 >ref|XP_023880599.1| conserved oligomeric Golgi complex subunit 6 [Quercus suber] ref|XP_023880605.1| conserved oligomeric Golgi complex subunit 6 [Quercus suber] gb|POF22986.1| conserved oligomeric golgi complex subunit 6 [Quercus suber] Length = 694 Score = 72.4 bits (176), Expect = 4e-12 Identities = 36/40 (90%), Positives = 37/40 (92%) Frame = -2 Query: 121 STTALAPGLSRKLKKVLETRTDTPDLLSSLNTLSSFYTEN 2 ST LAPGLSRKLKKVLE RTD+PDLLSSLNTLSSFYTEN Sbjct: 4 STVGLAPGLSRKLKKVLECRTDSPDLLSSLNTLSSFYTEN 43 >ref|XP_016201313.1| conserved oligomeric Golgi complex subunit 6 [Arachis ipaensis] Length = 694 Score = 72.4 bits (176), Expect = 4e-12 Identities = 38/43 (88%), Positives = 40/43 (93%), Gaps = 1/43 (2%) Frame = -2 Query: 127 MGSTTA-LAPGLSRKLKKVLETRTDTPDLLSSLNTLSSFYTEN 2 MG+T A LAPGLSRKLKKVLE+RTDTPDLLSSLNTLSSFY EN Sbjct: 1 MGTTVAGLAPGLSRKLKKVLESRTDTPDLLSSLNTLSSFYEEN 43 >ref|XP_015963463.1| conserved oligomeric Golgi complex subunit 6 [Arachis duranensis] Length = 694 Score = 72.4 bits (176), Expect = 4e-12 Identities = 38/43 (88%), Positives = 40/43 (93%), Gaps = 1/43 (2%) Frame = -2 Query: 127 MGSTTA-LAPGLSRKLKKVLETRTDTPDLLSSLNTLSSFYTEN 2 MG+T A LAPGLSRKLKKVLE+RTDTPDLLSSLNTLSSFY EN Sbjct: 1 MGTTVAGLAPGLSRKLKKVLESRTDTPDLLSSLNTLSSFYEEN 43 >dbj|GAV71124.1| COG6 domain-containing protein [Cephalotus follicularis] Length = 687 Score = 72.0 bits (175), Expect = 6e-12 Identities = 34/42 (80%), Positives = 39/42 (92%) Frame = -2 Query: 127 MGSTTALAPGLSRKLKKVLETRTDTPDLLSSLNTLSSFYTEN 2 MG+ LAPGLSRKLKKVLE+RTD+PDLLSSLNTLS+FYT+N Sbjct: 1 MGTAVGLAPGLSRKLKKVLESRTDSPDLLSSLNTLSTFYTDN 42 >ref|XP_019259871.1| PREDICTED: conserved oligomeric Golgi complex subunit 6 [Nicotiana attenuata] gb|OIT39545.1| hypothetical protein A4A49_15084 [Nicotiana attenuata] Length = 691 Score = 72.0 bits (175), Expect = 6e-12 Identities = 35/37 (94%), Positives = 37/37 (100%) Frame = -2 Query: 112 ALAPGLSRKLKKVLETRTDTPDLLSSLNTLSSFYTEN 2 ALAPGLSRKLKKVLETRTDTPDLL+SLNTLS+FYTEN Sbjct: 2 ALAPGLSRKLKKVLETRTDTPDLLASLNTLSTFYTEN 38 >ref|XP_009793211.1| PREDICTED: conserved oligomeric Golgi complex subunit 6 [Nicotiana sylvestris] ref|XP_016493065.1| PREDICTED: conserved oligomeric Golgi complex subunit 6-like [Nicotiana tabacum] Length = 691 Score = 72.0 bits (175), Expect = 6e-12 Identities = 35/37 (94%), Positives = 37/37 (100%) Frame = -2 Query: 112 ALAPGLSRKLKKVLETRTDTPDLLSSLNTLSSFYTEN 2 ALAPGLSRKLKKVLETRTDTPDLL+SLNTLS+FYTEN Sbjct: 2 ALAPGLSRKLKKVLETRTDTPDLLASLNTLSTFYTEN 38 >ref|XP_009592302.1| PREDICTED: conserved oligomeric Golgi complex subunit 6 [Nicotiana tomentosiformis] ref|XP_016495660.1| PREDICTED: conserved oligomeric Golgi complex subunit 6-like [Nicotiana tabacum] Length = 691 Score = 72.0 bits (175), Expect = 6e-12 Identities = 35/37 (94%), Positives = 37/37 (100%) Frame = -2 Query: 112 ALAPGLSRKLKKVLETRTDTPDLLSSLNTLSSFYTEN 2 ALAPGLSRKLKKVLETRTDTPDLL+SLNTLS+FYTEN Sbjct: 2 ALAPGLSRKLKKVLETRTDTPDLLASLNTLSTFYTEN 38 >ref|XP_021594892.1| conserved oligomeric Golgi complex subunit 6 [Manihot esculenta] gb|OAY30010.1| hypothetical protein MANES_15G189800 [Manihot esculenta] Length = 690 Score = 71.6 bits (174), Expect = 8e-12 Identities = 34/42 (80%), Positives = 39/42 (92%) Frame = -2 Query: 127 MGSTTALAPGLSRKLKKVLETRTDTPDLLSSLNTLSSFYTEN 2 MG+ T LAPGLSRKLKKVLE RTDTPDL+SSL+TLS+FYT+N Sbjct: 1 MGTATGLAPGLSRKLKKVLECRTDTPDLVSSLHTLSTFYTDN 42