BLASTX nr result
ID: Chrysanthemum21_contig00008552
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00008552 (1752 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS64483.1| hypothetical protein M569_10301, partial [Genlise... 57 2e-06 ref|XP_022881055.1| LIM domain-containing protein A-like [Olea e... 60 8e-06 >gb|EPS64483.1| hypothetical protein M569_10301, partial [Genlisea aurea] Length = 96 Score = 57.0 bits (136), Expect = 2e-06 Identities = 25/34 (73%), Positives = 31/34 (91%) Frame = -1 Query: 1077 GFYI*MDAKTFIQLVEEKKKRVLAKKEAPLKWQQ 976 G ++ MDAK F+QLVE+KKKR+LAKKEAPLKW+Q Sbjct: 12 GRFVSMDAKKFLQLVEDKKKRILAKKEAPLKWEQ 45 >ref|XP_022881055.1| LIM domain-containing protein A-like [Olea europaea var. sylvestris] Length = 425 Score = 60.1 bits (144), Expect = 8e-06 Identities = 28/33 (84%), Positives = 31/33 (93%) Frame = -1 Query: 1074 FYI*MDAKTFIQLVEEKKKRVLAKKEAPLKWQQ 976 FYI MDAK F+QLVEEKKKRVLAK+EAPLKW+Q Sbjct: 100 FYIKMDAKKFMQLVEEKKKRVLAKREAPLKWEQ 132