BLASTX nr result
ID: Chrysanthemum21_contig00008538
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00008538 (465 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_022027147.1| uncharacterized protein LOC110928436 [Helian... 55 6e-06 gb|OMO86351.1| hypothetical protein COLO4_21226 [Corchorus olito... 54 1e-05 gb|OMO67133.1| hypothetical protein CCACVL1_20768 [Corchorus cap... 54 1e-05 >ref|XP_022027147.1| uncharacterized protein LOC110928436 [Helianthus annuus] gb|OTG30041.1| hypothetical protein HannXRQ_Chr03g0060051 [Helianthus annuus] Length = 228 Score = 54.7 bits (130), Expect = 6e-06 Identities = 25/35 (71%), Positives = 32/35 (91%) Frame = -2 Query: 446 LSHVGDFAVLQKLDQVGNSLRRVHSLIEERQHKTS 342 +++ G+FA+LQKLD+VGNSL+RV SLIEERQ KTS Sbjct: 193 MANAGEFAILQKLDEVGNSLKRVQSLIEERQPKTS 227 >gb|OMO86351.1| hypothetical protein COLO4_21226 [Corchorus olitorius] Length = 259 Score = 54.3 bits (129), Expect = 1e-05 Identities = 23/42 (54%), Positives = 35/42 (83%) Frame = -2 Query: 455 HDTLSHVGDFAVLQKLDQVGNSLRRVHSLIEERQHKTSQCRD 330 HD + H GDFA+LQKL++VG+S++RV +LIEE++ +TS+ D Sbjct: 218 HDAIPHSGDFALLQKLEEVGSSVKRVQTLIEEQRSQTSETTD 259 >gb|OMO67133.1| hypothetical protein CCACVL1_20768 [Corchorus capsularis] Length = 259 Score = 54.3 bits (129), Expect = 1e-05 Identities = 23/42 (54%), Positives = 35/42 (83%) Frame = -2 Query: 455 HDTLSHVGDFAVLQKLDQVGNSLRRVHSLIEERQHKTSQCRD 330 HD + H GDFA+LQKL++VG+S++RV +LIEE++ +TS+ D Sbjct: 218 HDAIPHSGDFALLQKLEEVGSSVKRVQTLIEEQRSQTSETAD 259