BLASTX nr result
ID: Chrysanthemum21_contig00008370
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00008370 (378 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_017250157.1| PREDICTED: cell division control protein 6 h... 42 9e-06 >ref|XP_017250157.1| PREDICTED: cell division control protein 6 homolog B [Daucus carota subsp. sativus] gb|KZM95717.1| hypothetical protein DCAR_018959 [Daucus carota subsp. sativus] Length = 508 Score = 42.4 bits (98), Expect(2) = 9e-06 Identities = 19/30 (63%), Positives = 25/30 (83%) Frame = +3 Query: 51 KPMVVSFQAYSMDQIIMILKQGLMALPYSL 140 KPMVV+F+AYS DQII I++Q L LPY++ Sbjct: 283 KPMVVTFRAYSKDQIIKIIQQRLRVLPYTV 312 Score = 34.7 bits (78), Expect(2) = 9e-06 Identities = 15/19 (78%), Positives = 17/19 (89%) Frame = +1 Query: 133 TVFEPQALELCARKVAKSS 189 TVF+PQALE CARKVA +S Sbjct: 311 TVFQPQALEFCARKVASAS 329