BLASTX nr result
ID: Chrysanthemum21_contig00008145
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00008145 (589 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PON39320.1| hypothetical protein PanWU01x14_305740 [Parasponi... 60 2e-08 gb|PON89006.1| hypothetical protein TorRG33x02_152350, partial [... 59 8e-08 ref|XP_001640022.1| predicted protein [Nematostella vectensis] >... 57 3e-06 >gb|PON39320.1| hypothetical protein PanWU01x14_305740 [Parasponia andersonii] Length = 90 Score = 59.7 bits (143), Expect = 2e-08 Identities = 33/54 (61%), Positives = 37/54 (68%), Gaps = 1/54 (1%) Frame = -3 Query: 575 VIGLSQT-SPDFDGLISFKLFLRSL*DKNLSLHSGNVCSIWLLKLFPNFILLFI 417 ++GLS P G ISF F +SL DKNLS HSG V SIWLL+LFPNFI L I Sbjct: 31 LLGLSPAPEPAALGSISFNFFFKSLYDKNLSRHSGKVSSIWLLRLFPNFISLSI 84 >gb|PON89006.1| hypothetical protein TorRG33x02_152350, partial [Trema orientalis] Length = 128 Score = 58.9 bits (141), Expect = 8e-08 Identities = 32/52 (61%), Positives = 36/52 (69%), Gaps = 1/52 (1%) Frame = -3 Query: 575 VIGLSQT-SPDFDGLISFKLFLRSL*DKNLSLHSGNVCSIWLLKLFPNFILL 423 ++GLS P G ISF F +SL DKNLS HSG V SIWLL+LFPNFI L Sbjct: 31 LLGLSPAPEPAALGSISFNFFFKSLYDKNLSRHSGKVSSIWLLRLFPNFISL 82 >ref|XP_001640022.1| predicted protein [Nematostella vectensis] gb|EDO47959.1| predicted protein, partial [Nematostella vectensis] Length = 536 Score = 57.4 bits (137), Expect = 3e-06 Identities = 43/155 (27%), Positives = 65/155 (41%), Gaps = 2/155 (1%) Frame = -2 Query: 465 FYLVAQTLPKFHTSFYKRVWFFLGFQKWVCFFS*FQELGMNLFQNSRTGYESFSKFKNRV 286 F+ + F TSF FF F+ W FF+ F+ + F + + F+ FKN Sbjct: 279 FFTSFKNWKSFFTSFKNWKSFFTSFKNWKSFFTSFKN-WKSFFTSFKNWKSFFTSFKNWK 337 Query: 285 SIFM*FQKLGMNLFQISRNGYGIFSNFRKWV*VFSGFQ--KLGMNLFQTGYESLCDFKNW 112 S F F K + F +N F++F+ W F+ F+ K F+ FKNW Sbjct: 338 SFFTSF-KNWKSFFTSFKNWKSFFTSFKNWKSFFTSFKNWKSFFTSFKNWKSFFTSFKNW 396 Query: 111 V*IFFKIQELGINLYVISKTGYESFSKFKNWVSIF 7 F ++ + + K F+ FKNW S F Sbjct: 397 KSFFTSLKNWK-SFFTSFKNWKSFFTSFKNWKSFF 430 Score = 56.6 bits (135), Expect = 6e-06 Identities = 44/155 (28%), Positives = 65/155 (41%), Gaps = 2/155 (1%) Frame = -2 Query: 465 FYLVAQTLPKFHTSFYKRVWFFLGFQKWVCFFS*FQELGMNLFQNSRTGYESFSKFKNRV 286 F+ + F TSF FF F+ W FF+ F+ + F + + F+ FKN Sbjct: 159 FFTSFKNWKSFFTSFKNWKSFFTSFKNWKSFFTSFKN-WKSFFTSFKNWKSFFTSFKNWK 217 Query: 285 SIFM*FQKLGMNLFQISRNGYGIFSNFRKWV*VFSGFQ--KLGMNLFQTGYESLCDFKNW 112 S F F K + F +N F++F+ W F+ F+ K F+ FKNW Sbjct: 218 SFFTSF-KNWKSFFTSFKNWKSFFTSFKNWKSFFTSFKNWKSFFTSFKNWKSFFTSFKNW 276 Query: 111 V*IFFKIQELGINLYVISKTGYESFSKFKNWVSIF 7 FF + + + K F+ FKNW S F Sbjct: 277 K-SFFTSFKNWKSFFTSFKNWKSFFTSFKNWKSFF 310 Score = 56.6 bits (135), Expect = 6e-06 Identities = 43/155 (27%), Positives = 64/155 (41%), Gaps = 2/155 (1%) Frame = -2 Query: 465 FYLVAQTLPKFHTSFYKRVWFFLGFQKWVCFFS*FQELGMNLFQNSRTGYESFSKFKNRV 286 F+ + F TSF FF F+ W FF+ F+ + F + + F+ FKN Sbjct: 329 FFTSFKNWKSFFTSFKNWKSFFTSFKNWKSFFTSFKNW-KSFFTSFKNWKSFFTSFKNWK 387 Query: 285 SIFM*FQKLGMNLFQISRNGYGIFSNFRKWV*VFSGFQ--KLGMNLFQTGYESLCDFKNW 112 S F F K + F +N F++F+ W F+ F+ K F+ FKNW Sbjct: 388 SFFTSF-KNWKSFFTSLKNWKSFFTSFKNWKSFFTSFKNWKSFFTSFKNWKSFFTSFKNW 446 Query: 111 V*IFFKIQELGINLYVISKTGYESFSKFKNWVSIF 7 F + + + K F+ FKNW S F Sbjct: 447 KSFFTSFKNWK-SFFTSFKNWKSFFTSFKNWKSFF 480 Score = 56.6 bits (135), Expect = 6e-06 Identities = 43/155 (27%), Positives = 64/155 (41%), Gaps = 2/155 (1%) Frame = -2 Query: 465 FYLVAQTLPKFHTSFYKRVWFFLGFQKWVCFFS*FQELGMNLFQNSRTGYESFSKFKNRV 286 F+ + F TSF FF F+ W FF+ F+ + F + + F+ FKN Sbjct: 359 FFTSFKNWKSFFTSFKNWKSFFTSFKNWKSFFTSFKNW-KSFFTSLKNWKSFFTSFKNWK 417 Query: 285 SIFM*FQKLGMNLFQISRNGYGIFSNFRKWV*VFSGFQ--KLGMNLFQTGYESLCDFKNW 112 S F F K + F +N F++F+ W F+ F+ K F+ FKNW Sbjct: 418 SFFTSF-KNWKSFFTSFKNWKSFFTSFKNWKSFFTSFKNWKSFFTSFKNWKSFFTSFKNW 476 Query: 111 V*IFFKIQELGINLYVISKTGYESFSKFKNWVSIF 7 F + + + K F+ FKNW S F Sbjct: 477 KSFFTSFKNWK-SFFTSFKNWKSFFTSFKNWKSFF 510 Score = 56.2 bits (134), Expect = 8e-06 Identities = 44/160 (27%), Positives = 66/160 (41%), Gaps = 2/160 (1%) Frame = -2 Query: 480 FRQCLFYLVAQTLPKFHTSFYKRVWFFLGFQKWVCFFS*FQELGMNLFQNSRTGYESFSK 301 F+ + + F TSF FF F+ W FF+ F+ + F + + F+ Sbjct: 74 FKNWKSFFTFKNWKSFFTSFKNWKSFFTSFKNWKSFFTSFKN-WKSFFTSFKNWKSFFTS 132 Query: 300 FKNRVSIFM*FQKLGMNLFQISRNGYGIFSNFRKWV*VFSGFQ--KLGMNLFQTGYESLC 127 FKN S F F K + F +N F++F+ W F+ F+ K F+ Sbjct: 133 FKNWKSFFTSF-KNWKSFFTSFKNWKSFFTSFKNWKSFFTSFKNWKSFFTSFKNWKSFFT 191 Query: 126 DFKNWV*IFFKIQELGINLYVISKTGYESFSKFKNWVSIF 7 FKNW FF + + + K F+ FKNW S F Sbjct: 192 SFKNWK-SFFTSFKNWKSFFTSFKNWKSFFTSFKNWKSFF 230