BLASTX nr result
ID: Chrysanthemum21_contig00008144
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00008144 (437 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PON89006.1| hypothetical protein TorRG33x02_152350, partial [... 60 1e-08 gb|PON39320.1| hypothetical protein PanWU01x14_305740 [Parasponi... 58 3e-08 >gb|PON89006.1| hypothetical protein TorRG33x02_152350, partial [Trema orientalis] Length = 128 Score = 60.1 bits (144), Expect = 1e-08 Identities = 33/56 (58%), Positives = 38/56 (67%), Gaps = 4/56 (7%) Frame = -1 Query: 428 GLISFKLFLRSL*DKNLSLHSGNVCSIWLLKLFPNFILL----FNKKVWFFLGFQK 273 G ISF F +SL DKNLS HSG V SIWLL+LFPNFI L + K+ FFL +K Sbjct: 44 GSISFNFFFKSLYDKNLSRHSGKVSSIWLLRLFPNFISLSLYIYRCKLLFFLKEKK 99 >gb|PON39320.1| hypothetical protein PanWU01x14_305740 [Parasponia andersonii] Length = 90 Score = 57.8 bits (138), Expect = 3e-08 Identities = 28/39 (71%), Positives = 30/39 (76%) Frame = -1 Query: 428 GLISFKLFLRSL*DKNLSLHSGNVCSIWLLKLFPNFILL 312 G ISF F +SL DKNLS HSG V SIWLL+LFPNFI L Sbjct: 44 GSISFNFFFKSLYDKNLSRHSGKVSSIWLLRLFPNFISL 82