BLASTX nr result
ID: Chrysanthemum21_contig00007945
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00007945 (877 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020689040.1| plasma membrane ATPase 4-like [Dendrobium ca... 58 1e-05 >ref|XP_020689040.1| plasma membrane ATPase 4-like [Dendrobium catenatum] gb|PKU64560.1| Plasma membrane ATPase 4 [Dendrobium catenatum] Length = 948 Score = 58.2 bits (139), Expect = 1e-05 Identities = 27/47 (57%), Positives = 33/47 (70%) Frame = +3 Query: 735 DVTYACIVGILPDPKEP*SGISEMRFLTFNPVVRQTETTSINESGKW 875 D ACIVG+L DPKE +GI E+ FL FNPV ++T T I+E GKW Sbjct: 372 DAIDACIVGMLADPKEARAGIKEVHFLPFNPVEKRTAITYIDEQGKW 418