BLASTX nr result
ID: Chrysanthemum21_contig00007931
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00007931 (493 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_068729.1| putative reverse transcriptase [Soybean chlorot... 60 2e-07 >ref|NP_068729.1| putative reverse transcriptase [Soybean chlorotic mottle virus] sp|P15629.2|POL_SOCMV RecName: Full=Enzymatic polyprotein; Includes: RecName: Full=Aspartic protease; Includes: RecName: Full=Endonuclease; Includes: RecName: Full=Reverse transcriptase emb|CAC16945.1| putative reverse transcriptase [Soybean chlorotic mottle virus] Length = 692 Score = 60.1 bits (144), Expect = 2e-07 Identities = 25/40 (62%), Positives = 31/40 (77%) Frame = +2 Query: 293 TERSKGRLINWQITLNQYEPYIKYIKSEDNSFADTLTREW 412 T+ GRLI WQ+ L Y+PY++ IKSE+N FADTLTREW Sbjct: 647 TDYRNGRLIRWQLRLQAYQPYVELIKSENNPFADTLTREW 686