BLASTX nr result
ID: Chrysanthemum21_contig00007806
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00007806 (545 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_022028877.1| mediator of RNA polymerase II transcription ... 61 1e-07 ref|XP_022001707.1| mediator of RNA polymerase II transcription ... 59 1e-06 gb|KVH91385.1| Coactivator CBP, KIX domain-containing protein [C... 58 1e-06 >ref|XP_022028877.1| mediator of RNA polymerase II transcription subunit 15a-like [Helianthus annuus] ref|XP_022028878.1| mediator of RNA polymerase II transcription subunit 15a-like [Helianthus annuus] ref|XP_022028879.1| mediator of RNA polymerase II transcription subunit 15a-like [Helianthus annuus] ref|XP_022028880.1| mediator of RNA polymerase II transcription subunit 15a-like [Helianthus annuus] gb|OTG31872.1| putative coactivator CBP, KIX domain-containing protein [Helianthus annuus] Length = 1290 Score = 61.2 bits (147), Expect = 1e-07 Identities = 31/37 (83%), Positives = 32/37 (86%) Frame = +1 Query: 1 YHQQLKSGALFSPQLLSAASPQMSQRASPKIDQ*IMF 111 YHQQLK GA FSPQLLSAASPQMSQ ASP+IDQ MF Sbjct: 880 YHQQLKPGAPFSPQLLSAASPQMSQHASPQIDQSNMF 916 >ref|XP_022001707.1| mediator of RNA polymerase II transcription subunit 15a-like [Helianthus annuus] ref|XP_022001708.1| mediator of RNA polymerase II transcription subunit 15a-like [Helianthus annuus] ref|XP_022001709.1| mediator of RNA polymerase II transcription subunit 15a-like [Helianthus annuus] ref|XP_022001710.1| mediator of RNA polymerase II transcription subunit 15a-like [Helianthus annuus] gb|OTG02165.1| hypothetical protein HannXRQ_Chr13g0410001 [Helianthus annuus] Length = 1237 Score = 58.5 bits (140), Expect = 1e-06 Identities = 28/33 (84%), Positives = 30/33 (90%) Frame = +1 Query: 1 YHQQLKSGALFSPQLLSAASPQMSQRASPKIDQ 99 YHQQLK GA FSPQLLS+ASPQMSQ ASP+IDQ Sbjct: 826 YHQQLKPGAPFSPQLLSSASPQMSQHASPQIDQ 858 >gb|KVH91385.1| Coactivator CBP, KIX domain-containing protein [Cynara cardunculus var. scolymus] Length = 1117 Score = 58.2 bits (139), Expect = 1e-06 Identities = 29/37 (78%), Positives = 31/37 (83%) Frame = +1 Query: 1 YHQQLKSGALFSPQLLSAASPQMSQRASPKIDQ*IMF 111 YHQQLKSGA FSPQLL AASPQMSQ SP+IDQ +F Sbjct: 695 YHQQLKSGAPFSPQLLPAASPQMSQHPSPQIDQQNLF 731