BLASTX nr result
ID: Chrysanthemum21_contig00007255
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00007255 (361 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_023753485.1| zinc transporter 5-like [Lactuca sativa] >gi... 58 2e-07 gb|KVH89209.1| Zinc/iron permease [Cynara cardunculus var. scoly... 55 2e-06 >ref|XP_023753485.1| zinc transporter 5-like [Lactuca sativa] gb|PLY93307.1| hypothetical protein LSAT_4X150921 [Lactuca sativa] Length = 355 Score = 58.2 bits (139), Expect = 2e-07 Identities = 28/45 (62%), Positives = 28/45 (62%) Frame = +3 Query: 225 TTQVLCECTCEREEDEGKKSEALKYKXXXXXXXXXXXXXXVCIPF 359 TT V ECTCEREEDEGKKSEALKYK VCIPF Sbjct: 19 TTNVFAECTCEREEDEGKKSEALKYKLIALASILIFGAIGVCIPF 63 >gb|KVH89209.1| Zinc/iron permease [Cynara cardunculus var. scolymus] Length = 357 Score = 55.5 bits (132), Expect = 2e-06 Identities = 26/45 (57%), Positives = 29/45 (64%) Frame = +3 Query: 225 TTQVLCECTCEREEDEGKKSEALKYKXXXXXXXXXXXXXXVCIPF 359 TTQVL +CTCE+EEDEGKKSEA +YK VCIPF Sbjct: 18 TTQVLADCTCEQEEDEGKKSEAQRYKLIALASILIFGAIGVCIPF 62