BLASTX nr result
ID: Chrysanthemum21_contig00006784
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00006784 (840 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KVH93275.1| Homeodomain-like protein [Cynara cardunculus var.... 60 2e-06 >gb|KVH93275.1| Homeodomain-like protein [Cynara cardunculus var. scolymus] Length = 657 Score = 59.7 bits (143), Expect = 2e-06 Identities = 31/44 (70%), Positives = 36/44 (81%), Gaps = 2/44 (4%) Frame = +2 Query: 713 FGTDLSMIKECISGCTREQIQV--QKEERKQPSRLNNALTTHAK 838 FGTDLSMIKEC G TREQI+ +KEER+QP RL++ALTT AK Sbjct: 570 FGTDLSMIKECFPGRTREQIKAKYKKEERQQPLRLSDALTTRAK 613