BLASTX nr result
ID: Chrysanthemum21_contig00006729
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00006729 (425 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_023734974.1| small acidic protein 1-like [Lactuca sativa] 62 2e-10 gb|OTG02203.1| putative small acidic protein 2 [Helianthus annuus] 62 3e-10 gb|PLY72933.1| hypothetical protein LSAT_1X76160 [Lactuca sativa] 59 5e-09 >ref|XP_023734974.1| small acidic protein 1-like [Lactuca sativa] Length = 64 Score = 62.4 bits (150), Expect = 2e-10 Identities = 29/46 (63%), Positives = 38/46 (82%) Frame = -3 Query: 378 MKAMPVEMYGEMEEQTMMTSAMEVDDVDSFDVFGESPLSSLDH*RL 241 MK MPVE++GEMEEQ T AM+VDDV++ D+FGE P+++LDH RL Sbjct: 1 MKPMPVELFGEMEEQAS-TVAMDVDDVEALDIFGEGPIAALDHHRL 45 >gb|OTG02203.1| putative small acidic protein 2 [Helianthus annuus] Length = 64 Score = 62.0 bits (149), Expect = 3e-10 Identities = 29/46 (63%), Positives = 38/46 (82%) Frame = -3 Query: 378 MKAMPVEMYGEMEEQTMMTSAMEVDDVDSFDVFGESPLSSLDH*RL 241 MK MPVE++GEME+Q T AM+VDDV++ D+FGE PL++LDH RL Sbjct: 1 MKPMPVELFGEMEDQAS-TVAMDVDDVEALDIFGEGPLAALDHHRL 45 >gb|PLY72933.1| hypothetical protein LSAT_1X76160 [Lactuca sativa] Length = 61 Score = 58.9 bits (141), Expect = 5e-09 Identities = 27/43 (62%), Positives = 36/43 (83%) Frame = -3 Query: 369 MPVEMYGEMEEQTMMTSAMEVDDVDSFDVFGESPLSSLDH*RL 241 MPVE++GEMEEQ T AM+VDDV++ D+FGE P+++LDH RL Sbjct: 1 MPVELFGEMEEQAS-TVAMDVDDVEALDIFGEGPIAALDHHRL 42