BLASTX nr result
ID: Chrysanthemum21_contig00006728
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00006728 (404 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_023734974.1| small acidic protein 1-like [Lactuca sativa] 65 3e-11 gb|OTG02203.1| putative small acidic protein 2 [Helianthus annuus] 64 4e-11 gb|PLY72933.1| hypothetical protein LSAT_1X76160 [Lactuca sativa] 61 5e-10 >ref|XP_023734974.1| small acidic protein 1-like [Lactuca sativa] Length = 64 Score = 64.7 bits (156), Expect = 3e-11 Identities = 29/46 (63%), Positives = 39/46 (84%) Frame = -3 Query: 357 MKAMPVEMYGEMEEQTMMTSAMEVDDVDSFDVFGESPLSSLDHYRL 220 MK MPVE++GEMEEQ T AM+VDDV++ D+FGE P+++LDH+RL Sbjct: 1 MKPMPVELFGEMEEQAS-TVAMDVDDVEALDIFGEGPIAALDHHRL 45 >gb|OTG02203.1| putative small acidic protein 2 [Helianthus annuus] Length = 64 Score = 64.3 bits (155), Expect = 4e-11 Identities = 29/46 (63%), Positives = 39/46 (84%) Frame = -3 Query: 357 MKAMPVEMYGEMEEQTMMTSAMEVDDVDSFDVFGESPLSSLDHYRL 220 MK MPVE++GEME+Q T AM+VDDV++ D+FGE PL++LDH+RL Sbjct: 1 MKPMPVELFGEMEDQAS-TVAMDVDDVEALDIFGEGPLAALDHHRL 45 >gb|PLY72933.1| hypothetical protein LSAT_1X76160 [Lactuca sativa] Length = 61 Score = 61.2 bits (147), Expect = 5e-10 Identities = 27/43 (62%), Positives = 37/43 (86%) Frame = -3 Query: 348 MPVEMYGEMEEQTMMTSAMEVDDVDSFDVFGESPLSSLDHYRL 220 MPVE++GEMEEQ T AM+VDDV++ D+FGE P+++LDH+RL Sbjct: 1 MPVELFGEMEEQAS-TVAMDVDDVEALDIFGEGPIAALDHHRL 42