BLASTX nr result
ID: Chrysanthemum21_contig00006483
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00006483 (643 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_023773234.1| VAN3-binding protein [Lactuca sativa] 47 4e-06 >ref|XP_023773234.1| VAN3-binding protein [Lactuca sativa] Length = 453 Score = 47.4 bits (111), Expect(2) = 4e-06 Identities = 24/41 (58%), Positives = 31/41 (75%), Gaps = 2/41 (4%) Frame = +2 Query: 317 VKSHCDIVTL--ASATGFYGAATLKSKVLNKLWNITAAIPM 433 VKSH DI+TL A+AT GAATLK++ L ++WNI A IP+ Sbjct: 259 VKSHGDILTLTAAAATALRGAATLKARALKEVWNIAAVIPV 299 Score = 31.6 bits (70), Expect(2) = 4e-06 Identities = 14/29 (48%), Positives = 18/29 (62%) Frame = +1 Query: 226 TLATTVYPAFKSTKVMGAEREHLIVVVNS 312 T+A ++ + MGAEREHLI VNS Sbjct: 227 TIAAAAAQCVEAAEAMGAEREHLIAAVNS 255