BLASTX nr result
ID: Chrysanthemum21_contig00006453
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00006453 (458 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|OLQ02390.1| hypothetical protein AK812_SmicGene14778 [Symbiod... 55 8e-06 >gb|OLQ02390.1| hypothetical protein AK812_SmicGene14778 [Symbiodinium microadriaticum] Length = 1379 Score = 55.1 bits (131), Expect = 8e-06 Identities = 25/61 (40%), Positives = 32/61 (52%) Frame = -2 Query: 445 RPHTHHDLTNNNTSHPPRPHKHKTSPSSRPQNHHDFTNITTSHPPRPHQHHYLTIIRHHH 266 RPH HHD ++N H RPH H SR NHHD + H RPH H + + +H+ Sbjct: 341 RPHNHHDGCSHNYDHHSRPHNH--DHHSRSHNHHDGCSHNYDHHSRPHNHDHRSRPHNHN 398 Query: 265 D 263 D Sbjct: 399 D 399