BLASTX nr result
ID: Chrysanthemum21_contig00005748
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00005748 (406 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_021977104.1| thioredoxin F-type, chloroplastic-like [Heli... 82 1e-16 gb|OTG18234.1| putative thioredoxin [Helianthus annuus] 82 4e-16 ref|XP_023754575.1| thioredoxin F-type, chloroplastic-like [Lact... 79 9e-16 gb|KVI07476.1| Thioredoxin [Cynara cardunculus var. scolymus] 79 9e-16 ref|XP_024186419.1| thioredoxin F-type, chloroplastic-like isofo... 79 1e-15 ref|XP_024186418.1| thioredoxin F-type, chloroplastic-like isofo... 79 1e-15 gb|ABW38329.1| chloroplast thioredoxin f [Fragaria x ananassa] 79 1e-15 ref|XP_004302168.1| PREDICTED: thioredoxin F-type, chloroplastic... 79 2e-15 ref|XP_011466075.1| PREDICTED: thioredoxin F-type, chloroplastic... 79 2e-15 gb|PRQ41518.1| putative monodehydroascorbate reductase (NADH) [R... 79 2e-15 gb|OMO69903.1| Thioredoxin [Corchorus capsularis] 78 2e-15 gb|OMO61307.1| Thioredoxin [Corchorus olitorius] 78 3e-15 ref|XP_010673902.1| PREDICTED: thioredoxin F-type, chloroplastic... 78 4e-15 ref|XP_021673695.1| thioredoxin F-type, chloroplastic-like [Heve... 78 5e-15 ref|XP_022864623.1| thioredoxin F-type, chloroplastic-like [Olea... 77 6e-15 ref|XP_019263400.1| PREDICTED: thioredoxin F-type, chloroplastic... 77 6e-15 ref|XP_016439802.1| PREDICTED: thioredoxin F-type, chloroplastic... 77 6e-15 ref|XP_009588293.1| PREDICTED: thioredoxin F-type, chloroplastic... 77 6e-15 ref|XP_022719852.1| thioredoxin F-type, chloroplastic-like isofo... 77 7e-15 ref|XP_006371273.1| hypothetical protein POPTR_0019s08240g [Popu... 76 7e-15 >ref|XP_021977104.1| thioredoxin F-type, chloroplastic-like [Helianthus annuus] Length = 183 Score = 81.6 bits (200), Expect = 1e-16 Identities = 35/40 (87%), Positives = 36/40 (90%) Frame = -3 Query: 122 TTAVIGVVTEVDKDTFWPIVEDAGDKTVVLDMYTQWCGPC 3 T V+GVVTEVDKDTFWPIV AGDKTVVLDMYTQWCGPC Sbjct: 71 TAVVVGVVTEVDKDTFWPIVNAAGDKTVVLDMYTQWCGPC 110 >gb|OTG18234.1| putative thioredoxin [Helianthus annuus] Length = 245 Score = 81.6 bits (200), Expect = 4e-16 Identities = 35/40 (87%), Positives = 36/40 (90%) Frame = -3 Query: 122 TTAVIGVVTEVDKDTFWPIVEDAGDKTVVLDMYTQWCGPC 3 T V+GVVTEVDKDTFWPIV AGDKTVVLDMYTQWCGPC Sbjct: 133 TAVVVGVVTEVDKDTFWPIVNAAGDKTVVLDMYTQWCGPC 172 >ref|XP_023754575.1| thioredoxin F-type, chloroplastic-like [Lactuca sativa] gb|PLY92458.1| hypothetical protein LSAT_0X10780 [Lactuca sativa] Length = 180 Score = 79.3 bits (194), Expect = 9e-16 Identities = 34/39 (87%), Positives = 35/39 (89%) Frame = -3 Query: 119 TAVIGVVTEVDKDTFWPIVEDAGDKTVVLDMYTQWCGPC 3 T V+G VTEVDKDTFWPIV AGDKTVVLDMYTQWCGPC Sbjct: 69 TVVVGQVTEVDKDTFWPIVNAAGDKTVVLDMYTQWCGPC 107 >gb|KVI07476.1| Thioredoxin [Cynara cardunculus var. scolymus] Length = 185 Score = 79.3 bits (194), Expect = 9e-16 Identities = 34/40 (85%), Positives = 36/40 (90%) Frame = -3 Query: 122 TTAVIGVVTEVDKDTFWPIVEDAGDKTVVLDMYTQWCGPC 3 + AV+G VTEVDKDTFWPIV AGDKTVVLDMYTQWCGPC Sbjct: 73 SAAVVGQVTEVDKDTFWPIVNAAGDKTVVLDMYTQWCGPC 112 >ref|XP_024186419.1| thioredoxin F-type, chloroplastic-like isoform X2 [Rosa chinensis] Length = 183 Score = 79.0 bits (193), Expect = 1e-15 Identities = 33/40 (82%), Positives = 35/40 (87%) Frame = -3 Query: 122 TTAVIGVVTEVDKDTFWPIVEDAGDKTVVLDMYTQWCGPC 3 T A +G VTEVDKDTFWPIV AGDKT+VLDMYTQWCGPC Sbjct: 71 TAATVGQVTEVDKDTFWPIVNAAGDKTIVLDMYTQWCGPC 110 >ref|XP_024186418.1| thioredoxin F-type, chloroplastic-like isoform X1 [Rosa chinensis] Length = 184 Score = 79.0 bits (193), Expect = 1e-15 Identities = 33/40 (82%), Positives = 35/40 (87%) Frame = -3 Query: 122 TTAVIGVVTEVDKDTFWPIVEDAGDKTVVLDMYTQWCGPC 3 T A +G VTEVDKDTFWPIV AGDKT+VLDMYTQWCGPC Sbjct: 71 TAATVGQVTEVDKDTFWPIVNAAGDKTIVLDMYTQWCGPC 110 >gb|ABW38329.1| chloroplast thioredoxin f [Fragaria x ananassa] Length = 186 Score = 79.0 bits (193), Expect = 1e-15 Identities = 33/40 (82%), Positives = 35/40 (87%) Frame = -3 Query: 122 TTAVIGVVTEVDKDTFWPIVEDAGDKTVVLDMYTQWCGPC 3 T A +G VTEVDKDTFWPIV AGDKT+VLDMYTQWCGPC Sbjct: 74 TAATVGQVTEVDKDTFWPIVNAAGDKTIVLDMYTQWCGPC 113 >ref|XP_004302168.1| PREDICTED: thioredoxin F-type, chloroplastic-like isoform X3 [Fragaria vesca subsp. vesca] Length = 192 Score = 79.0 bits (193), Expect = 2e-15 Identities = 33/40 (82%), Positives = 35/40 (87%) Frame = -3 Query: 122 TTAVIGVVTEVDKDTFWPIVEDAGDKTVVLDMYTQWCGPC 3 T A +G VTEVDKDTFWPIV AGDKT+VLDMYTQWCGPC Sbjct: 80 TAATVGQVTEVDKDTFWPIVNAAGDKTIVLDMYTQWCGPC 119 >ref|XP_011466075.1| PREDICTED: thioredoxin F-type, chloroplastic-like isoform X2 [Fragaria vesca subsp. vesca] Length = 193 Score = 79.0 bits (193), Expect = 2e-15 Identities = 33/40 (82%), Positives = 35/40 (87%) Frame = -3 Query: 122 TTAVIGVVTEVDKDTFWPIVEDAGDKTVVLDMYTQWCGPC 3 T A +G VTEVDKDTFWPIV AGDKT+VLDMYTQWCGPC Sbjct: 80 TAATVGQVTEVDKDTFWPIVNAAGDKTIVLDMYTQWCGPC 119 >gb|PRQ41518.1| putative monodehydroascorbate reductase (NADH) [Rosa chinensis] Length = 195 Score = 79.0 bits (193), Expect = 2e-15 Identities = 33/40 (82%), Positives = 35/40 (87%) Frame = -3 Query: 122 TTAVIGVVTEVDKDTFWPIVEDAGDKTVVLDMYTQWCGPC 3 T A +G VTEVDKDTFWPIV AGDKT+VLDMYTQWCGPC Sbjct: 83 TAATVGQVTEVDKDTFWPIVNAAGDKTIVLDMYTQWCGPC 122 >gb|OMO69903.1| Thioredoxin [Corchorus capsularis] Length = 151 Score = 77.8 bits (190), Expect = 2e-15 Identities = 33/41 (80%), Positives = 36/41 (87%) Frame = -3 Query: 125 VTTAVIGVVTEVDKDTFWPIVEDAGDKTVVLDMYTQWCGPC 3 + A +G VTEV+KDTFWPIVE AGDKTVVLDMYTQWCGPC Sbjct: 77 IAGATVGQVTEVNKDTFWPIVEAAGDKTVVLDMYTQWCGPC 117 >gb|OMO61307.1| Thioredoxin [Corchorus olitorius] Length = 177 Score = 77.8 bits (190), Expect = 3e-15 Identities = 33/41 (80%), Positives = 36/41 (87%) Frame = -3 Query: 125 VTTAVIGVVTEVDKDTFWPIVEDAGDKTVVLDMYTQWCGPC 3 + A +G VTEV+KDTFWPIVE AGDKTVVLDMYTQWCGPC Sbjct: 64 IAGATVGQVTEVNKDTFWPIVEAAGDKTVVLDMYTQWCGPC 104 >ref|XP_010673902.1| PREDICTED: thioredoxin F-type, chloroplastic [Beta vulgaris subsp. vulgaris] gb|KMT14731.1| hypothetical protein BVRB_4g074970 [Beta vulgaris subsp. vulgaris] Length = 183 Score = 77.8 bits (190), Expect = 4e-15 Identities = 35/59 (59%), Positives = 42/59 (71%) Frame = -3 Query: 179 RNNVKVRXXXXXXXXXXSVTTAVIGVVTEVDKDTFWPIVEDAGDKTVVLDMYTQWCGPC 3 R N +VR + A++G VT+V+KDTFWPIV+ AGDKTVVLDMYTQWCGPC Sbjct: 52 RRNDRVRGQIRASMDVGTQVEAIVGKVTQVNKDTFWPIVKAAGDKTVVLDMYTQWCGPC 110 >ref|XP_021673695.1| thioredoxin F-type, chloroplastic-like [Hevea brasiliensis] Length = 195 Score = 77.8 bits (190), Expect = 5e-15 Identities = 33/39 (84%), Positives = 35/39 (89%) Frame = -3 Query: 119 TAVIGVVTEVDKDTFWPIVEDAGDKTVVLDMYTQWCGPC 3 TA +G VTEV KDTFWPIV+ AGDKTVVLDMYTQWCGPC Sbjct: 84 TATVGQVTEVTKDTFWPIVKSAGDKTVVLDMYTQWCGPC 122 >ref|XP_022864623.1| thioredoxin F-type, chloroplastic-like [Olea europaea var. sylvestris] Length = 191 Score = 77.4 bits (189), Expect = 6e-15 Identities = 33/38 (86%), Positives = 36/38 (94%) Frame = -3 Query: 116 AVIGVVTEVDKDTFWPIVEDAGDKTVVLDMYTQWCGPC 3 AV+G VTEV+KDTFWPIV+ AGDKTVVLDMYTQWCGPC Sbjct: 81 AVVGQVTEVNKDTFWPIVKAAGDKTVVLDMYTQWCGPC 118 >ref|XP_019263400.1| PREDICTED: thioredoxin F-type, chloroplastic-like [Nicotiana attenuata] gb|OIT37180.1| thioredoxin f1, chloroplastic [Nicotiana attenuata] Length = 175 Score = 77.0 bits (188), Expect = 6e-15 Identities = 33/40 (82%), Positives = 35/40 (87%) Frame = -3 Query: 122 TTAVIGVVTEVDKDTFWPIVEDAGDKTVVLDMYTQWCGPC 3 TT +G VTEV KDTFWPIVE AGDKTVV+DMYTQWCGPC Sbjct: 63 TTVTVGQVTEVCKDTFWPIVEAAGDKTVVVDMYTQWCGPC 102 >ref|XP_016439802.1| PREDICTED: thioredoxin F-type, chloroplastic-like [Nicotiana tabacum] Length = 175 Score = 77.0 bits (188), Expect = 6e-15 Identities = 33/40 (82%), Positives = 35/40 (87%) Frame = -3 Query: 122 TTAVIGVVTEVDKDTFWPIVEDAGDKTVVLDMYTQWCGPC 3 TT +G VTEV KDTFWPIVE AGDKTVV+DMYTQWCGPC Sbjct: 63 TTVTVGQVTEVCKDTFWPIVEAAGDKTVVVDMYTQWCGPC 102 >ref|XP_009588293.1| PREDICTED: thioredoxin F-type, chloroplastic-like [Nicotiana tomentosiformis] Length = 175 Score = 77.0 bits (188), Expect = 6e-15 Identities = 33/40 (82%), Positives = 35/40 (87%) Frame = -3 Query: 122 TTAVIGVVTEVDKDTFWPIVEDAGDKTVVLDMYTQWCGPC 3 TT +G VTEV KDTFWPIVE AGDKTVV+DMYTQWCGPC Sbjct: 63 TTVTVGQVTEVCKDTFWPIVEAAGDKTVVVDMYTQWCGPC 102 >ref|XP_022719852.1| thioredoxin F-type, chloroplastic-like isoform X2 [Durio zibethinus] Length = 164 Score = 76.6 bits (187), Expect = 7e-15 Identities = 33/40 (82%), Positives = 34/40 (85%) Frame = -3 Query: 122 TTAVIGVVTEVDKDTFWPIVEDAGDKTVVLDMYTQWCGPC 3 T A +G VTEV KDTFWPIV AGDKTVVLDMYTQWCGPC Sbjct: 76 TAATVGKVTEVTKDTFWPIVNAAGDKTVVLDMYTQWCGPC 115 >ref|XP_006371273.1| hypothetical protein POPTR_0019s08240g [Populus trichocarpa] gb|PNS90655.1| hypothetical protein POPTR_019G054800v3 [Populus trichocarpa] Length = 154 Score = 76.3 bits (186), Expect = 7e-15 Identities = 32/39 (82%), Positives = 34/39 (87%) Frame = -3 Query: 119 TAVIGVVTEVDKDTFWPIVEDAGDKTVVLDMYTQWCGPC 3 T+ +G VTEV KDTFWPIV AGDKTVVLDMYTQWCGPC Sbjct: 76 TSAVGQVTEVTKDTFWPIVNSAGDKTVVLDMYTQWCGPC 114