BLASTX nr result
ID: Chrysanthemum21_contig00005747
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00005747 (365 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_021977104.1| thioredoxin F-type, chloroplastic-like [Heli... 96 2e-22 ref|XP_023754575.1| thioredoxin F-type, chloroplastic-like [Lact... 96 2e-22 gb|OMO69903.1| Thioredoxin [Corchorus capsularis] 95 3e-22 gb|OMO61307.1| Thioredoxin [Corchorus olitorius] 95 5e-22 gb|OTG18234.1| putative thioredoxin [Helianthus annuus] 96 6e-22 ref|XP_009340388.1| PREDICTED: thioredoxin F-type, chloroplastic... 94 1e-21 ref|XP_009340351.1| PREDICTED: thioredoxin F-type, chloroplastic... 94 1e-21 ref|XP_018499304.1| PREDICTED: thioredoxin F-type, chloroplastic... 94 1e-21 ref|XP_009340387.1| PREDICTED: thioredoxin F-type, chloroplastic... 94 1e-21 ref|XP_018810316.1| PREDICTED: thioredoxin F-type, chloroplastic... 94 1e-21 gb|ABW38329.1| chloroplast thioredoxin f [Fragaria x ananassa] 94 2e-21 ref|XP_004302168.1| PREDICTED: thioredoxin F-type, chloroplastic... 94 2e-21 ref|XP_011466075.1| PREDICTED: thioredoxin F-type, chloroplastic... 94 2e-21 gb|KHN40482.1| Thioredoxin F-type, chloroplastic [Glycine soja] 93 2e-21 ref|NP_001236670.1| uncharacterized protein LOC100306555 [Glycin... 93 2e-21 ref|XP_023516257.1| thioredoxin F-type, chloroplastic-like [Cucu... 93 2e-21 ref|XP_022988428.1| thioredoxin F-type, chloroplastic-like [Cucu... 93 2e-21 ref|XP_017415969.1| PREDICTED: thioredoxin F-type, chloroplastic... 93 2e-21 ref|XP_014523208.1| thioredoxin F-type, chloroplastic [Vigna rad... 93 2e-21 gb|KRH40285.1| hypothetical protein GLYMA_09G249200 [Glycine max] 93 2e-21 >ref|XP_021977104.1| thioredoxin F-type, chloroplastic-like [Helianthus annuus] Length = 183 Score = 96.3 bits (238), Expect = 2e-22 Identities = 41/49 (83%), Positives = 45/49 (91%) Frame = -1 Query: 149 TTAVIGVVTEVDKDTFWPIVEDAGDKTVILDMYTQWCGPCKIMAPKFQE 3 T V+GVVTEVDKDTFWPIV AGDKTV+LDMYTQWCGPCKI+AP+FQE Sbjct: 71 TAVVVGVVTEVDKDTFWPIVNAAGDKTVVLDMYTQWCGPCKIIAPRFQE 119 >ref|XP_023754575.1| thioredoxin F-type, chloroplastic-like [Lactuca sativa] gb|PLY92458.1| hypothetical protein LSAT_0X10780 [Lactuca sativa] Length = 180 Score = 95.9 bits (237), Expect = 2e-22 Identities = 46/69 (66%), Positives = 52/69 (75%) Frame = -1 Query: 209 LRNNVKVRXXXXXXXXXXSVTTAVIGVVTEVDKDTFWPIVEDAGDKTVILDMYTQWCGPC 30 LR++V+VR T V+G VTEVDKDTFWPIV AGDKTV+LDMYTQWCGPC Sbjct: 53 LRSSVRVRSSLEMSGP-----TVVVGQVTEVDKDTFWPIVNAAGDKTVVLDMYTQWCGPC 107 Query: 29 KIMAPKFQE 3 KI+APKFQE Sbjct: 108 KIIAPKFQE 116 >gb|OMO69903.1| Thioredoxin [Corchorus capsularis] Length = 151 Score = 94.7 bits (234), Expect = 3e-22 Identities = 40/50 (80%), Positives = 45/50 (90%) Frame = -1 Query: 152 VTTAVIGVVTEVDKDTFWPIVEDAGDKTVILDMYTQWCGPCKIMAPKFQE 3 + A +G VTEV+KDTFWPIVE AGDKTV+LDMYTQWCGPCK+MAPKFQE Sbjct: 77 IAGATVGQVTEVNKDTFWPIVEAAGDKTVVLDMYTQWCGPCKVMAPKFQE 126 >gb|OMO61307.1| Thioredoxin [Corchorus olitorius] Length = 177 Score = 94.7 bits (234), Expect = 5e-22 Identities = 40/50 (80%), Positives = 45/50 (90%) Frame = -1 Query: 152 VTTAVIGVVTEVDKDTFWPIVEDAGDKTVILDMYTQWCGPCKIMAPKFQE 3 + A +G VTEV+KDTFWPIVE AGDKTV+LDMYTQWCGPCK+MAPKFQE Sbjct: 64 IAGATVGQVTEVNKDTFWPIVEAAGDKTVVLDMYTQWCGPCKVMAPKFQE 113 >gb|OTG18234.1| putative thioredoxin [Helianthus annuus] Length = 245 Score = 96.3 bits (238), Expect = 6e-22 Identities = 41/49 (83%), Positives = 45/49 (91%) Frame = -1 Query: 149 TTAVIGVVTEVDKDTFWPIVEDAGDKTVILDMYTQWCGPCKIMAPKFQE 3 T V+GVVTEVDKDTFWPIV AGDKTV+LDMYTQWCGPCKI+AP+FQE Sbjct: 133 TAVVVGVVTEVDKDTFWPIVNAAGDKTVVLDMYTQWCGPCKIIAPRFQE 181 >ref|XP_009340388.1| PREDICTED: thioredoxin F-type, chloroplastic-like isoform X2 [Pyrus x bretschneideri] Length = 186 Score = 94.0 bits (232), Expect = 1e-21 Identities = 40/48 (83%), Positives = 44/48 (91%) Frame = -1 Query: 146 TAVIGVVTEVDKDTFWPIVEDAGDKTVILDMYTQWCGPCKIMAPKFQE 3 T +G VTEVDKDTFWPIV+ AGDKTV+LDMYTQWCGPCK+MAPKFQE Sbjct: 75 TVNVGQVTEVDKDTFWPIVKAAGDKTVVLDMYTQWCGPCKVMAPKFQE 122 >ref|XP_009340351.1| PREDICTED: thioredoxin F-type, chloroplastic-like isoform X2 [Pyrus x bretschneideri] Length = 186 Score = 94.0 bits (232), Expect = 1e-21 Identities = 40/48 (83%), Positives = 44/48 (91%) Frame = -1 Query: 146 TAVIGVVTEVDKDTFWPIVEDAGDKTVILDMYTQWCGPCKIMAPKFQE 3 T +G VTEVDKDTFWPIV+ AGDKTV+LDMYTQWCGPCK+MAPKFQE Sbjct: 75 TVNVGQVTEVDKDTFWPIVKAAGDKTVVLDMYTQWCGPCKVMAPKFQE 122 >ref|XP_018499304.1| PREDICTED: thioredoxin F-type, chloroplastic-like isoform X1 [Pyrus x bretschneideri] Length = 187 Score = 94.0 bits (232), Expect = 1e-21 Identities = 40/48 (83%), Positives = 44/48 (91%) Frame = -1 Query: 146 TAVIGVVTEVDKDTFWPIVEDAGDKTVILDMYTQWCGPCKIMAPKFQE 3 T +G VTEVDKDTFWPIV+ AGDKTV+LDMYTQWCGPCK+MAPKFQE Sbjct: 75 TVNVGQVTEVDKDTFWPIVKAAGDKTVVLDMYTQWCGPCKVMAPKFQE 122 >ref|XP_009340387.1| PREDICTED: thioredoxin F-type, chloroplastic-like isoform X1 [Pyrus x bretschneideri] Length = 187 Score = 94.0 bits (232), Expect = 1e-21 Identities = 40/48 (83%), Positives = 44/48 (91%) Frame = -1 Query: 146 TAVIGVVTEVDKDTFWPIVEDAGDKTVILDMYTQWCGPCKIMAPKFQE 3 T +G VTEVDKDTFWPIV+ AGDKTV+LDMYTQWCGPCK+MAPKFQE Sbjct: 75 TVNVGQVTEVDKDTFWPIVKAAGDKTVVLDMYTQWCGPCKVMAPKFQE 122 >ref|XP_018810316.1| PREDICTED: thioredoxin F-type, chloroplastic-like [Juglans regia] Length = 176 Score = 93.6 bits (231), Expect = 1e-21 Identities = 39/48 (81%), Positives = 44/48 (91%) Frame = -1 Query: 146 TAVIGVVTEVDKDTFWPIVEDAGDKTVILDMYTQWCGPCKIMAPKFQE 3 T +G VTEVDKDTFWP+V+ AGDKTV+LDMYTQWCGPCK+MAPKFQE Sbjct: 65 TVKVGQVTEVDKDTFWPLVKAAGDKTVVLDMYTQWCGPCKVMAPKFQE 112 >gb|ABW38329.1| chloroplast thioredoxin f [Fragaria x ananassa] Length = 186 Score = 93.6 bits (231), Expect = 2e-21 Identities = 39/49 (79%), Positives = 44/49 (89%) Frame = -1 Query: 149 TTAVIGVVTEVDKDTFWPIVEDAGDKTVILDMYTQWCGPCKIMAPKFQE 3 T A +G VTEVDKDTFWPIV AGDKT++LDMYTQWCGPCKI+APK+QE Sbjct: 74 TAATVGQVTEVDKDTFWPIVNAAGDKTIVLDMYTQWCGPCKIIAPKYQE 122 >ref|XP_004302168.1| PREDICTED: thioredoxin F-type, chloroplastic-like isoform X3 [Fragaria vesca subsp. vesca] Length = 192 Score = 93.6 bits (231), Expect = 2e-21 Identities = 39/49 (79%), Positives = 44/49 (89%) Frame = -1 Query: 149 TTAVIGVVTEVDKDTFWPIVEDAGDKTVILDMYTQWCGPCKIMAPKFQE 3 T A +G VTEVDKDTFWPIV AGDKT++LDMYTQWCGPCKI+APK+QE Sbjct: 80 TAATVGQVTEVDKDTFWPIVNAAGDKTIVLDMYTQWCGPCKIIAPKYQE 128 >ref|XP_011466075.1| PREDICTED: thioredoxin F-type, chloroplastic-like isoform X2 [Fragaria vesca subsp. vesca] Length = 193 Score = 93.6 bits (231), Expect = 2e-21 Identities = 39/49 (79%), Positives = 44/49 (89%) Frame = -1 Query: 149 TTAVIGVVTEVDKDTFWPIVEDAGDKTVILDMYTQWCGPCKIMAPKFQE 3 T A +G VTEVDKDTFWPIV AGDKT++LDMYTQWCGPCKI+APK+QE Sbjct: 80 TAATVGQVTEVDKDTFWPIVNAAGDKTIVLDMYTQWCGPCKIIAPKYQE 128 >gb|KHN40482.1| Thioredoxin F-type, chloroplastic [Glycine soja] Length = 179 Score = 93.2 bits (230), Expect = 2e-21 Identities = 39/48 (81%), Positives = 44/48 (91%) Frame = -1 Query: 146 TAVIGVVTEVDKDTFWPIVEDAGDKTVILDMYTQWCGPCKIMAPKFQE 3 T +G VTEV+KDTFWPIV+ AGDKTV+LDMYTQWCGPCK+MAPKFQE Sbjct: 68 TVTVGQVTEVNKDTFWPIVKAAGDKTVVLDMYTQWCGPCKVMAPKFQE 115 >ref|NP_001236670.1| uncharacterized protein LOC100306555 [Glycine max] gb|ACU14778.1| unknown [Glycine max] gb|KRH00940.1| hypothetical protein GLYMA_18G243200 [Glycine max] Length = 179 Score = 93.2 bits (230), Expect = 2e-21 Identities = 39/48 (81%), Positives = 44/48 (91%) Frame = -1 Query: 146 TAVIGVVTEVDKDTFWPIVEDAGDKTVILDMYTQWCGPCKIMAPKFQE 3 T +G VTEV+KDTFWPIV+ AGDKTV+LDMYTQWCGPCK+MAPKFQE Sbjct: 68 TVTVGQVTEVNKDTFWPIVKAAGDKTVVLDMYTQWCGPCKVMAPKFQE 115 >ref|XP_023516257.1| thioredoxin F-type, chloroplastic-like [Cucurbita pepo subsp. pepo] Length = 180 Score = 93.2 bits (230), Expect = 2e-21 Identities = 39/47 (82%), Positives = 43/47 (91%) Frame = -1 Query: 143 AVIGVVTEVDKDTFWPIVEDAGDKTVILDMYTQWCGPCKIMAPKFQE 3 A +G VTEV+KDTFWPIV AGDKTV+LDMYTQWCGPCK+MAPKFQE Sbjct: 70 ATVGTVTEVNKDTFWPIVNAAGDKTVVLDMYTQWCGPCKVMAPKFQE 116 >ref|XP_022988428.1| thioredoxin F-type, chloroplastic-like [Cucurbita maxima] Length = 180 Score = 93.2 bits (230), Expect = 2e-21 Identities = 39/47 (82%), Positives = 43/47 (91%) Frame = -1 Query: 143 AVIGVVTEVDKDTFWPIVEDAGDKTVILDMYTQWCGPCKIMAPKFQE 3 A +G VTEV+KDTFWPIV AGDKTV+LDMYTQWCGPCK+MAPKFQE Sbjct: 70 ATVGTVTEVNKDTFWPIVNAAGDKTVVLDMYTQWCGPCKVMAPKFQE 116 >ref|XP_017415969.1| PREDICTED: thioredoxin F-type, chloroplastic [Vigna angularis] dbj|BAT83515.1| hypothetical protein VIGAN_04067400 [Vigna angularis var. angularis] Length = 181 Score = 93.2 bits (230), Expect = 2e-21 Identities = 39/48 (81%), Positives = 44/48 (91%) Frame = -1 Query: 146 TAVIGVVTEVDKDTFWPIVEDAGDKTVILDMYTQWCGPCKIMAPKFQE 3 T +G VTEV+KDTFWPIV+ AGDKTV+LDMYTQWCGPCK+MAPKFQE Sbjct: 70 TVTVGQVTEVNKDTFWPIVKAAGDKTVVLDMYTQWCGPCKVMAPKFQE 117 >ref|XP_014523208.1| thioredoxin F-type, chloroplastic [Vigna radiata var. radiata] Length = 181 Score = 93.2 bits (230), Expect = 2e-21 Identities = 39/48 (81%), Positives = 44/48 (91%) Frame = -1 Query: 146 TAVIGVVTEVDKDTFWPIVEDAGDKTVILDMYTQWCGPCKIMAPKFQE 3 T +G VTEV+KDTFWPIV+ AGDKTV+LDMYTQWCGPCK+MAPKFQE Sbjct: 70 TVTVGQVTEVNKDTFWPIVKAAGDKTVVLDMYTQWCGPCKVMAPKFQE 117 >gb|KRH40285.1| hypothetical protein GLYMA_09G249200 [Glycine max] Length = 181 Score = 93.2 bits (230), Expect = 2e-21 Identities = 39/48 (81%), Positives = 44/48 (91%) Frame = -1 Query: 146 TAVIGVVTEVDKDTFWPIVEDAGDKTVILDMYTQWCGPCKIMAPKFQE 3 T +G VTEV+KDTFWPIV+ AGDKTV+LDMYTQWCGPCK+MAPKFQE Sbjct: 70 TVTVGQVTEVNKDTFWPIVKAAGDKTVVLDMYTQWCGPCKVMAPKFQE 117