BLASTX nr result
ID: Chrysanthemum21_contig00005439
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00005439 (364 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AGA60919.1| hypothetical protein, partial [Mimulus sookensis]... 100 4e-25 gb|AGA60918.1| hypothetical protein, partial [Mimulus sookensis]... 99 1e-24 gb|AGA61019.1| hypothetical protein, partial [Erythranthe geyeri] 99 3e-24 ref|XP_021994034.1| ankyrin repeat domain-containing protein 13A... 104 1e-23 gb|KVH91002.1| Ankyrin repeat-containing protein [Cynara cardunc... 102 6e-23 ref|XP_023736408.1| ankyrin repeat domain-containing protein 13C... 102 1e-22 gb|KVI00294.1| Ankyrin repeat-containing protein [Cynara cardunc... 101 1e-22 ref|XP_012844185.1| PREDICTED: uncharacterized protein LOC105964... 100 3e-22 gb|PHU21452.1| hypothetical protein BC332_06559 [Capsicum chinense] 100 4e-22 ref|XP_016566088.1| PREDICTED: ankyrin repeat domain-containing ... 100 4e-22 ref|XP_009798595.1| PREDICTED: ankyrin repeat domain-containing ... 99 9e-22 gb|PHT39191.1| hypothetical protein CQW23_22764 [Capsicum baccatum] 99 9e-22 ref|XP_011091404.1| uncharacterized protein LOC105171856 [Sesamu... 99 2e-21 ref|XP_016497749.1| PREDICTED: ankyrin repeat domain-containing ... 98 2e-21 ref|XP_019246102.1| PREDICTED: ankyrin repeat domain-containing ... 98 2e-21 ref|XP_009601455.1| PREDICTED: ankyrin repeat domain-containing ... 98 2e-21 emb|CDO99416.1| unnamed protein product [Coffea canephora] 98 2e-21 ref|XP_022873734.1| uncharacterized protein LOC111392607 [Olea e... 98 2e-21 ref|XP_022026738.1| uncharacterized protein LOC110927368 [Helian... 98 2e-21 ref|XP_019233741.1| PREDICTED: ankyrin repeat domain-containing ... 98 3e-21 >gb|AGA60919.1| hypothetical protein, partial [Mimulus sookensis] gb|AGA60921.1| hypothetical protein, partial [Mimulus sookensis] gb|AGA60922.1| hypothetical protein, partial [Mimulus sookensis] gb|AGA60923.1| hypothetical protein, partial [Mimulus sookensis] gb|AGA60924.1| hypothetical protein, partial [Mimulus sookensis] gb|AGA60925.1| hypothetical protein, partial [Mimulus sookensis] gb|AGA60926.1| hypothetical protein, partial [Mimulus sookensis] gb|AGA60927.1| hypothetical protein, partial [Mimulus sookensis] gb|AGA60929.1| hypothetical protein, partial [Mimulus sookensis] gb|AGA60931.1| hypothetical protein, partial [Mimulus sookensis] gb|AGA60933.1| hypothetical protein, partial [Mimulus sookensis] gb|AGA60934.1| hypothetical protein, partial [Erythranthe guttata] gb|AGA60935.1| hypothetical protein, partial [Erythranthe guttata] gb|AGA60936.1| hypothetical protein, partial [Erythranthe guttata] gb|AGA60937.1| hypothetical protein, partial [Erythranthe guttata] gb|AGA60939.1| hypothetical protein, partial [Mimulus sookensis] gb|AGA60941.1| hypothetical protein, partial [Mimulus sookensis] gb|AGA60942.1| hypothetical protein, partial [Mimulus sookensis] gb|AGA60943.1| hypothetical protein, partial [Mimulus sookensis] gb|AGA60944.1| hypothetical protein, partial [Mimulus sookensis] gb|AGA60945.1| hypothetical protein, partial [Mimulus sookensis] gb|AGA60946.1| hypothetical protein, partial [Erythranthe guttata] gb|AGA60947.1| hypothetical protein, partial [Erythranthe guttata] gb|AGA60948.1| hypothetical protein, partial [Mimulus sookensis] gb|AGA60949.1| hypothetical protein, partial [Mimulus sookensis] gb|AGA60951.1| hypothetical protein, partial [Mimulus sookensis] gb|AGA60953.1| hypothetical protein, partial [Mimulus sookensis] gb|AGA60955.1| hypothetical protein, partial [Mimulus sookensis] gb|AGA60957.1| hypothetical protein, partial [Mimulus sookensis] gb|AGA60958.1| hypothetical protein, partial [Mimulus sookensis] gb|AGA60959.1| hypothetical protein, partial [Mimulus sookensis] gb|AGA60960.1| hypothetical protein, partial [Mimulus sookensis] gb|AGA60961.1| hypothetical protein, partial [Mimulus sookensis] gb|AGA60962.1| hypothetical protein, partial [Mimulus sookensis] gb|AGA60963.1| hypothetical protein, partial [Mimulus sookensis] gb|AGA60964.1| hypothetical protein, partial [Mimulus sookensis] gb|AGA60965.1| hypothetical protein, partial [Mimulus sookensis] gb|AGA60966.1| hypothetical protein, partial [Erythranthe guttata] gb|AGA60967.1| hypothetical protein, partial [Erythranthe guttata] gb|AGA60968.1| hypothetical protein, partial [Erythranthe guttata] gb|AGA60969.1| hypothetical protein, partial [Erythranthe guttata] gb|AGA60970.1| hypothetical protein, partial [Mimulus sookensis] gb|AGA60971.1| hypothetical protein, partial [Mimulus sookensis] gb|AGA60972.1| hypothetical protein, partial [Mimulus sookensis] gb|AGA60973.1| hypothetical protein, partial [Mimulus sookensis] gb|AGA60975.1| hypothetical protein, partial [Mimulus sookensis] gb|AGA60976.1| hypothetical protein, partial [Erythranthe guttata] gb|AGA60977.1| hypothetical protein, partial [Erythranthe guttata] gb|AGA60979.1| hypothetical protein, partial [Mimulus sookensis] gb|AGA60981.1| hypothetical protein, partial [Mimulus sookensis] gb|AGA60982.1| hypothetical protein, partial [Erythranthe guttata] gb|AGA60983.1| hypothetical protein, partial [Erythranthe guttata] gb|AGA60984.1| hypothetical protein, partial [Erythranthe guttata] gb|AGA60985.1| hypothetical protein, partial [Erythranthe guttata] gb|AGA60986.1| hypothetical protein, partial [Erythranthe guttata] gb|AGA60987.1| hypothetical protein, partial [Erythranthe guttata] gb|AGA60988.1| hypothetical protein, partial [Erythranthe nasuta] gb|AGA60989.1| hypothetical protein, partial [Erythranthe guttata] gb|AGA60990.1| hypothetical protein, partial [Erythranthe guttata] gb|AGA60991.1| hypothetical protein, partial [Erythranthe guttata] gb|AGA60992.1| hypothetical protein, partial [Erythranthe guttata] gb|AGA60993.1| hypothetical protein, partial [Erythranthe guttata] gb|AGA60994.1| hypothetical protein, partial [Erythranthe nasuta] gb|AGA60995.1| hypothetical protein, partial [Erythranthe guttata] gb|AGA60996.1| hypothetical protein, partial [Erythranthe guttata] gb|AGA60997.1| hypothetical protein, partial [Erythranthe guttata] gb|AGA60998.1| hypothetical protein, partial [Erythranthe guttata] gb|AGA60999.1| hypothetical protein, partial [Erythranthe guttata] gb|AGA61000.1| hypothetical protein, partial [Erythranthe guttata] gb|AGA61001.1| hypothetical protein, partial [Erythranthe guttata] gb|AGA61002.1| hypothetical protein, partial [Erythranthe guttata] gb|AGA61003.1| hypothetical protein, partial [Erythranthe guttata] gb|AGA61004.1| hypothetical protein, partial [Erythranthe guttata] gb|AGA61005.1| hypothetical protein, partial [Erythranthe guttata] gb|AGA61006.1| hypothetical protein, partial [Erythranthe nasuta] gb|AGA61007.1| hypothetical protein, partial [Erythranthe guttata] gb|AGA61008.1| hypothetical protein, partial [Erythranthe nasuta] gb|AGA61009.1| hypothetical protein, partial [Erythranthe nasuta] gb|AGA61010.1| hypothetical protein, partial [Erythranthe nasuta] gb|AGA61011.1| hypothetical protein, partial [Erythranthe guttata] gb|AGA61012.1| hypothetical protein, partial [Erythranthe guttata] gb|AGA61013.1| hypothetical protein, partial [Erythranthe guttata] gb|AGA61014.1| hypothetical protein, partial [Erythranthe guttata] gb|AGA61015.1| hypothetical protein, partial [Erythranthe guttata] gb|AGA61016.1| hypothetical protein, partial [Erythranthe guttata] gb|AGA61017.1| hypothetical protein, partial [Erythranthe guttata] gb|AGA61018.1| hypothetical protein, partial [Erythranthe guttata] gb|AGA61020.1| hypothetical protein, partial [Erythranthe nasuta] gb|AGA61021.1| hypothetical protein, partial [Erythranthe guttata] gb|AGA61022.1| hypothetical protein, partial [Erythranthe guttata] gb|AGA61023.1| hypothetical protein, partial [Erythranthe nasuta] gb|AGA61024.1| hypothetical protein, partial [Erythranthe guttata] gb|AGA61025.1| hypothetical protein, partial [Erythranthe guttata] gb|AGA61026.1| hypothetical protein, partial [Erythranthe guttata] gb|AGA61027.1| hypothetical protein, partial [Erythranthe nasuta] gb|AGA61028.1| hypothetical protein, partial [Erythranthe guttata] gb|AGA61029.1| hypothetical protein, partial [Erythranthe nasuta] gb|AGA61030.1| hypothetical protein, partial [Erythranthe guttata] gb|AGA61031.1| hypothetical protein, partial [Erythranthe guttata] gb|AGA61032.1| hypothetical protein, partial [Erythranthe guttata] gb|AGA61033.1| hypothetical protein, partial [Erythranthe guttata] gb|AGA61034.1| hypothetical protein, partial [Erythranthe guttata] gb|AGA61035.1| hypothetical protein, partial [Erythranthe guttata] gb|AGA61036.1| hypothetical protein, partial [Erythranthe guttata] gb|AGA61037.1| hypothetical protein, partial [Erythranthe guttata] gb|AGA61038.1| hypothetical protein, partial [Erythranthe nasuta] gb|AGA61039.1| hypothetical protein, partial [Erythranthe nasuta] gb|AGA61040.1| hypothetical protein, partial [Erythranthe nasuta] gb|AGA61041.1| hypothetical protein, partial [Erythranthe nasuta] gb|AGA61042.1| hypothetical protein, partial [Erythranthe guttata] gb|AGA61043.1| hypothetical protein, partial [Erythranthe guttata] gb|AGA61044.1| hypothetical protein, partial [Erythranthe guttata] gb|AGA61045.1| hypothetical protein, partial [Erythranthe guttata] gb|AGA61046.1| hypothetical protein, partial [Erythranthe guttata] gb|AGA61047.1| hypothetical protein, partial [Erythranthe nasuta] gb|AGA61048.1| hypothetical protein, partial [Erythranthe guttata] gb|AGA61049.1| hypothetical protein, partial [Erythranthe guttata] gb|AGA61050.1| hypothetical protein, partial [Erythranthe guttata] gb|AGA61051.1| hypothetical protein, partial [Erythranthe guttata] gb|AGA61052.1| hypothetical protein, partial [Erythranthe guttata] gb|AGA61053.1| hypothetical protein, partial [Erythranthe guttata] gb|AGA61054.1| hypothetical protein, partial [Mimulus sookensis] gb|AGA61055.1| hypothetical protein, partial [Mimulus sookensis] gb|AGA61056.1| hypothetical protein, partial [Mimulus sookensis] gb|AGA61057.1| hypothetical protein, partial [Erythranthe guttata] gb|AGA61058.1| hypothetical protein, partial [Erythranthe nasuta] Length = 113 Score = 100 bits (250), Expect = 4e-25 Identities = 47/68 (69%), Positives = 57/68 (83%) Frame = -3 Query: 209 MESIDVTLYSHSPVHKAVINKDYAALKKIIAGLPKFIDSSEVKTESASIAEEAKADVISS 30 M S+DV+ Y HSPVHKA+I KDYA L+KIIAGLP+ D SE+ TES S+AEEAKAD+I++ Sbjct: 1 MSSVDVSKYEHSPVHKAIILKDYAGLRKIIAGLPRLCDPSEIHTESVSLAEEAKADIIAA 60 Query: 29 VIDRRDVP 6 IDRRDVP Sbjct: 61 AIDRRDVP 68 >gb|AGA60918.1| hypothetical protein, partial [Mimulus sookensis] gb|AGA60920.1| hypothetical protein, partial [Mimulus sookensis] gb|AGA60928.1| hypothetical protein, partial [Mimulus sookensis] gb|AGA60930.1| hypothetical protein, partial [Mimulus sookensis] gb|AGA60932.1| hypothetical protein, partial [Mimulus sookensis] gb|AGA60938.1| hypothetical protein, partial [Mimulus sookensis] gb|AGA60940.1| hypothetical protein, partial [Mimulus sookensis] gb|AGA60950.1| hypothetical protein, partial [Mimulus sookensis] gb|AGA60952.1| hypothetical protein, partial [Mimulus sookensis] gb|AGA60954.1| hypothetical protein, partial [Mimulus sookensis] gb|AGA60956.1| hypothetical protein, partial [Mimulus sookensis] gb|AGA60974.1| hypothetical protein, partial [Mimulus sookensis] gb|AGA60978.1| hypothetical protein, partial [Mimulus sookensis] gb|AGA60980.1| hypothetical protein, partial [Mimulus sookensis] Length = 113 Score = 99.4 bits (246), Expect = 1e-24 Identities = 46/68 (67%), Positives = 57/68 (83%) Frame = -3 Query: 209 MESIDVTLYSHSPVHKAVINKDYAALKKIIAGLPKFIDSSEVKTESASIAEEAKADVISS 30 M S+DV+ Y HSPVHKA+I KDYA L+KIIAGLP+ D SE+ TES S+AEEA+AD+I++ Sbjct: 1 MSSVDVSKYEHSPVHKAIILKDYAGLRKIIAGLPRLCDPSEIHTESVSLAEEAEADIIAA 60 Query: 29 VIDRRDVP 6 IDRRDVP Sbjct: 61 AIDRRDVP 68 >gb|AGA61019.1| hypothetical protein, partial [Erythranthe geyeri] Length = 113 Score = 98.6 bits (244), Expect = 3e-24 Identities = 46/68 (67%), Positives = 56/68 (82%) Frame = -3 Query: 209 MESIDVTLYSHSPVHKAVINKDYAALKKIIAGLPKFIDSSEVKTESASIAEEAKADVISS 30 M S+DV+ Y HSPVHKA+I KDYA L+KIIA LP+ D SE+ TES S+AEEAKAD+I++ Sbjct: 1 MSSVDVSKYEHSPVHKAIILKDYAGLRKIIASLPRLCDPSEIHTESVSLAEEAKADIIAA 60 Query: 29 VIDRRDVP 6 IDRRDVP Sbjct: 61 AIDRRDVP 68 >ref|XP_021994034.1| ankyrin repeat domain-containing protein 13A-like [Helianthus annuus] gb|OTG08520.1| putative ankyrin repeat family protein [Helianthus annuus] Length = 617 Score = 104 bits (260), Expect = 1e-23 Identities = 49/69 (71%), Positives = 59/69 (85%) Frame = -3 Query: 209 MESIDVTLYSHSPVHKAVINKDYAALKKIIAGLPKFIDSSEVKTESASIAEEAKADVISS 30 ME++DV Y+HSPVHKAV+ KDY LKKIIAGLP+ +D S ++TES S+AEEAKAD IS+ Sbjct: 1 METLDVAPYAHSPVHKAVLTKDYTGLKKIIAGLPRLVDPSMIRTESDSVAEEAKADAISA 60 Query: 29 VIDRRDVPN 3 VIDRRDVPN Sbjct: 61 VIDRRDVPN 69 >gb|KVH91002.1| Ankyrin repeat-containing protein [Cynara cardunculus var. scolymus] Length = 663 Score = 102 bits (255), Expect = 6e-23 Identities = 49/69 (71%), Positives = 56/69 (81%) Frame = -3 Query: 209 MESIDVTLYSHSPVHKAVINKDYAALKKIIAGLPKFIDSSEVKTESASIAEEAKADVISS 30 M +IDVT Y+HSP HKAV+ KDY LKKIIAGLP+ D SE+ ES S+AEEAKAD IS+ Sbjct: 1 MAAIDVTKYAHSPTHKAVVTKDYGGLKKIIAGLPRLCDPSEIHNESVSLAEEAKADAISA 60 Query: 29 VIDRRDVPN 3 VIDRRDVPN Sbjct: 61 VIDRRDVPN 69 >ref|XP_023736408.1| ankyrin repeat domain-containing protein 13C-A-like [Lactuca sativa] ref|XP_023736409.1| ankyrin repeat domain-containing protein 13C-A-like [Lactuca sativa] gb|PLY71789.1| hypothetical protein LSAT_6X61621 [Lactuca sativa] Length = 671 Score = 102 bits (253), Expect = 1e-22 Identities = 49/69 (71%), Positives = 55/69 (79%) Frame = -3 Query: 209 MESIDVTLYSHSPVHKAVINKDYAALKKIIAGLPKFIDSSEVKTESASIAEEAKADVISS 30 M +IDVT YSHSP HKAV+ KDY L+KIIAGLP+ D SE+ ES S+ EEAKAD ISS Sbjct: 1 MAAIDVTKYSHSPTHKAVVTKDYGGLRKIIAGLPRLCDPSEIHNESISLTEEAKADTISS 60 Query: 29 VIDRRDVPN 3 VIDRRDVPN Sbjct: 61 VIDRRDVPN 69 >gb|KVI00294.1| Ankyrin repeat-containing protein [Cynara cardunculus var. scolymus] Length = 626 Score = 101 bits (252), Expect = 1e-22 Identities = 49/69 (71%), Positives = 58/69 (84%) Frame = -3 Query: 209 MESIDVTLYSHSPVHKAVINKDYAALKKIIAGLPKFIDSSEVKTESASIAEEAKADVISS 30 M +IDV YSHSP HKAV+ KDY+ L+KII+GLP+ D SE++TES SIAEEAKAD IS+ Sbjct: 1 MAAIDVAPYSHSPAHKAVLTKDYSNLRKIISGLPRLCDPSEIRTESDSIAEEAKADAISA 60 Query: 29 VIDRRDVPN 3 VIDRRDVPN Sbjct: 61 VIDRRDVPN 69 >ref|XP_012844185.1| PREDICTED: uncharacterized protein LOC105964204 [Erythranthe guttata] ref|XP_012844186.1| PREDICTED: uncharacterized protein LOC105964204 [Erythranthe guttata] ref|XP_012844187.1| PREDICTED: uncharacterized protein LOC105964204 [Erythranthe guttata] gb|EYU31733.1| hypothetical protein MIMGU_mgv1a002666mg [Erythranthe guttata] Length = 648 Score = 100 bits (250), Expect = 3e-22 Identities = 47/68 (69%), Positives = 57/68 (83%) Frame = -3 Query: 209 MESIDVTLYSHSPVHKAVINKDYAALKKIIAGLPKFIDSSEVKTESASIAEEAKADVISS 30 M S+DV+ Y HSPVHKA+I KDYA L+KIIAGLP+ D SE+ TES S+AEEAKAD+I++ Sbjct: 1 MSSVDVSKYEHSPVHKAIILKDYAGLRKIIAGLPRLCDPSEIHTESVSLAEEAKADIIAA 60 Query: 29 VIDRRDVP 6 IDRRDVP Sbjct: 61 AIDRRDVP 68 >gb|PHU21452.1| hypothetical protein BC332_06559 [Capsicum chinense] Length = 656 Score = 100 bits (249), Expect = 4e-22 Identities = 48/69 (69%), Positives = 57/69 (82%) Frame = -3 Query: 209 MESIDVTLYSHSPVHKAVINKDYAALKKIIAGLPKFIDSSEVKTESASIAEEAKADVISS 30 M DV+ Y HSPVHKA+I KDYA+L+KIIAGLP+ D +E+ TE+ S+AEEAKAD ISS Sbjct: 1 MAGTDVSKYGHSPVHKAIILKDYASLRKIIAGLPRLCDPAEIHTEAVSLAEEAKADAISS 60 Query: 29 VIDRRDVPN 3 VIDRRDVPN Sbjct: 61 VIDRRDVPN 69 >ref|XP_016566088.1| PREDICTED: ankyrin repeat domain-containing protein 13C [Capsicum annuum] ref|XP_016566089.1| PREDICTED: ankyrin repeat domain-containing protein 13C [Capsicum annuum] gb|PHT85422.1| hypothetical protein T459_07528 [Capsicum annuum] Length = 656 Score = 100 bits (249), Expect = 4e-22 Identities = 48/69 (69%), Positives = 57/69 (82%) Frame = -3 Query: 209 MESIDVTLYSHSPVHKAVINKDYAALKKIIAGLPKFIDSSEVKTESASIAEEAKADVISS 30 M DV+ Y HSPVHKA+I KDYA+L+KIIAGLP+ D +E+ TE+ S+AEEAKAD ISS Sbjct: 1 MAGTDVSKYGHSPVHKAIILKDYASLRKIIAGLPRLCDPTEIHTEAVSLAEEAKADAISS 60 Query: 29 VIDRRDVPN 3 VIDRRDVPN Sbjct: 61 VIDRRDVPN 69 >ref|XP_009798595.1| PREDICTED: ankyrin repeat domain-containing protein 13C-like [Nicotiana sylvestris] ref|XP_009798596.1| PREDICTED: ankyrin repeat domain-containing protein 13C-like [Nicotiana sylvestris] ref|XP_009798597.1| PREDICTED: ankyrin repeat domain-containing protein 13C-like [Nicotiana sylvestris] ref|XP_016442475.1| PREDICTED: ankyrin repeat domain-containing protein 13C-like [Nicotiana tabacum] ref|XP_016442476.1| PREDICTED: ankyrin repeat domain-containing protein 13C-like [Nicotiana tabacum] Length = 592 Score = 99.4 bits (246), Expect = 9e-22 Identities = 47/69 (68%), Positives = 58/69 (84%) Frame = -3 Query: 209 MESIDVTLYSHSPVHKAVINKDYAALKKIIAGLPKFIDSSEVKTESASIAEEAKADVISS 30 M S DV+ Y+HSP+HKA I KDYA+L+KII GLP+ D++E+ TES S+AEEAKAD IS+ Sbjct: 1 MTSFDVSKYAHSPMHKATILKDYASLRKIILGLPRLCDTAEIHTESVSLAEEAKADAISA 60 Query: 29 VIDRRDVPN 3 VIDRRDVPN Sbjct: 61 VIDRRDVPN 69 >gb|PHT39191.1| hypothetical protein CQW23_22764 [Capsicum baccatum] Length = 656 Score = 99.4 bits (246), Expect = 9e-22 Identities = 47/69 (68%), Positives = 57/69 (82%) Frame = -3 Query: 209 MESIDVTLYSHSPVHKAVINKDYAALKKIIAGLPKFIDSSEVKTESASIAEEAKADVISS 30 M DV+ Y HSPVHKA+I KDYA+L+KIIAGLP+ D +E+ TE+ S+AEEAKAD IS+ Sbjct: 1 MAGTDVSKYGHSPVHKAIILKDYASLRKIIAGLPRLCDPAEIHTEAVSLAEEAKADAISA 60 Query: 29 VIDRRDVPN 3 VIDRRDVPN Sbjct: 61 VIDRRDVPN 69 >ref|XP_011091404.1| uncharacterized protein LOC105171856 [Sesamum indicum] ref|XP_011091405.1| uncharacterized protein LOC105171856 [Sesamum indicum] Length = 649 Score = 98.6 bits (244), Expect = 2e-21 Identities = 45/69 (65%), Positives = 56/69 (81%) Frame = -3 Query: 209 MESIDVTLYSHSPVHKAVINKDYAALKKIIAGLPKFIDSSEVKTESASIAEEAKADVISS 30 M S+DV+ Y HSPVHK +I KDYA L++I+AGLP+ D SE+ TES S+AEEAKAD I++ Sbjct: 1 MSSVDVSKYEHSPVHKTIILKDYAGLRRILAGLPRLCDPSEIHTESVSLAEEAKADAIAA 60 Query: 29 VIDRRDVPN 3 IDRRDVPN Sbjct: 61 AIDRRDVPN 69 >ref|XP_016497749.1| PREDICTED: ankyrin repeat domain-containing protein 13B-like isoform X1 [Nicotiana tabacum] Length = 506 Score = 98.2 bits (243), Expect = 2e-21 Identities = 46/69 (66%), Positives = 58/69 (84%) Frame = -3 Query: 209 MESIDVTLYSHSPVHKAVINKDYAALKKIIAGLPKFIDSSEVKTESASIAEEAKADVISS 30 M S DV+ Y+HSP+HKA I KDYA+L+KII GLP+ D++E+ TE+ S+AEEAKAD IS+ Sbjct: 1 MTSFDVSKYAHSPMHKATILKDYASLRKIILGLPRLCDTAEIHTETVSLAEEAKADAISA 60 Query: 29 VIDRRDVPN 3 VIDRRDVPN Sbjct: 61 VIDRRDVPN 69 >ref|XP_019246102.1| PREDICTED: ankyrin repeat domain-containing protein 13C-like [Nicotiana attenuata] gb|OIT07953.1| hypothetical protein A4A49_03830 [Nicotiana attenuata] Length = 592 Score = 98.2 bits (243), Expect = 2e-21 Identities = 47/69 (68%), Positives = 57/69 (82%) Frame = -3 Query: 209 MESIDVTLYSHSPVHKAVINKDYAALKKIIAGLPKFIDSSEVKTESASIAEEAKADVISS 30 M S DV+ Y+HSP+HKA I KDYA+L KII GLP+ D++E+ TES S+AEEAKAD IS+ Sbjct: 1 MTSFDVSKYAHSPMHKATILKDYASLSKIILGLPRLCDTAEIHTESLSLAEEAKADAISA 60 Query: 29 VIDRRDVPN 3 VIDRRDVPN Sbjct: 61 VIDRRDVPN 69 >ref|XP_009601455.1| PREDICTED: ankyrin repeat domain-containing protein 13C-like isoform X1 [Nicotiana tomentosiformis] ref|XP_009601456.1| PREDICTED: ankyrin repeat domain-containing protein 13C-like isoform X1 [Nicotiana tomentosiformis] Length = 592 Score = 98.2 bits (243), Expect = 2e-21 Identities = 46/69 (66%), Positives = 58/69 (84%) Frame = -3 Query: 209 MESIDVTLYSHSPVHKAVINKDYAALKKIIAGLPKFIDSSEVKTESASIAEEAKADVISS 30 M S DV+ Y+HSP+HKA I KDYA+L+KII GLP+ D++E+ TE+ S+AEEAKAD IS+ Sbjct: 1 MTSFDVSKYAHSPMHKATILKDYASLRKIILGLPRLCDTAEIHTETVSLAEEAKADAISA 60 Query: 29 VIDRRDVPN 3 VIDRRDVPN Sbjct: 61 VIDRRDVPN 69 >emb|CDO99416.1| unnamed protein product [Coffea canephora] Length = 635 Score = 98.2 bits (243), Expect = 2e-21 Identities = 47/69 (68%), Positives = 57/69 (82%) Frame = -3 Query: 209 MESIDVTLYSHSPVHKAVINKDYAALKKIIAGLPKFIDSSEVKTESASIAEEAKADVISS 30 M SIDV Y+HSPVHKA+I KDYA L++IIAGLP+ D +E+ +E+ S+AEEAKAD IS Sbjct: 1 MASIDVGKYAHSPVHKAIILKDYAGLRRIIAGLPRLCDPAEIHSEAVSVAEEAKADAISV 60 Query: 29 VIDRRDVPN 3 VIDRRDVPN Sbjct: 61 VIDRRDVPN 69 >ref|XP_022873734.1| uncharacterized protein LOC111392607 [Olea europaea var. sylvestris] ref|XP_022873735.1| uncharacterized protein LOC111392607 [Olea europaea var. sylvestris] Length = 650 Score = 98.2 bits (243), Expect = 2e-21 Identities = 46/69 (66%), Positives = 57/69 (82%) Frame = -3 Query: 209 MESIDVTLYSHSPVHKAVINKDYAALKKIIAGLPKFIDSSEVKTESASIAEEAKADVISS 30 M +DV+ Y HSPVHKA+I KDYAAL++IIA LP+ D +E+ +ES S+AEEAKAD IS+ Sbjct: 1 MAGVDVSKYGHSPVHKAIILKDYAALRRIIASLPRLCDPAEIHSESVSLAEEAKADAISA 60 Query: 29 VIDRRDVPN 3 VIDRRDVPN Sbjct: 61 VIDRRDVPN 69 >ref|XP_022026738.1| uncharacterized protein LOC110927368 [Helianthus annuus] Length = 679 Score = 98.2 bits (243), Expect = 2e-21 Identities = 47/69 (68%), Positives = 56/69 (81%) Frame = -3 Query: 209 MESIDVTLYSHSPVHKAVINKDYAALKKIIAGLPKFIDSSEVKTESASIAEEAKADVISS 30 M +IDVT YSHSP HKAV+ +DY AL+KIIAGLP+ D SE+ ES S+AEEAKA+ IS+ Sbjct: 1 MAAIDVTKYSHSPTHKAVVTRDYTALRKIIAGLPRLCDPSEIHNESVSLAEEAKAEAISA 60 Query: 29 VIDRRDVPN 3 VIDRRDV N Sbjct: 61 VIDRRDVVN 69 >ref|XP_019233741.1| PREDICTED: ankyrin repeat domain-containing protein 13C-B [Nicotiana attenuata] gb|OIT06821.1| hypothetical protein A4A49_10126 [Nicotiana attenuata] Length = 651 Score = 97.8 bits (242), Expect = 3e-21 Identities = 46/69 (66%), Positives = 57/69 (82%) Frame = -3 Query: 209 MESIDVTLYSHSPVHKAVINKDYAALKKIIAGLPKFIDSSEVKTESASIAEEAKADVISS 30 M IDV+ Y+HSPVHKA++ KDYA+L+KIIA LP+ D +E+ TES S+AEE KAD IS+ Sbjct: 1 MAGIDVSKYAHSPVHKALVLKDYASLRKIIAALPRLCDPAEIHTESVSLAEEVKADAISA 60 Query: 29 VIDRRDVPN 3 VIDRRDVPN Sbjct: 61 VIDRRDVPN 69