BLASTX nr result
ID: Chrysanthemum21_contig00005151
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00005151 (374 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KVH90404.1| hypothetical protein Ccrd_007577 [Cynara carduncu... 61 2e-08 ref|XP_023765815.1| uncharacterized protein LOC111914272 [Lactuc... 56 2e-06 >gb|KVH90404.1| hypothetical protein Ccrd_007577 [Cynara cardunculus var. scolymus] Length = 306 Score = 60.8 bits (146), Expect = 2e-08 Identities = 27/46 (58%), Positives = 38/46 (82%) Frame = +3 Query: 72 IASMVQKKQELQAQNLELKAKKQKISYTRNMEDMQLWNNPMKVNLD 209 I +M +Q+L AQNLELKAK+Q+I+Y++N+ED +LWNN M +NLD Sbjct: 140 IRAMETLRQKLGAQNLELKAKRQEINYSKNIEDFRLWNNSMNMNLD 185 >ref|XP_023765815.1| uncharacterized protein LOC111914272 [Lactuca sativa] gb|PLY84006.1| hypothetical protein LSAT_8X30660 [Lactuca sativa] Length = 327 Score = 55.8 bits (133), Expect = 2e-06 Identities = 27/48 (56%), Positives = 37/48 (77%) Frame = +3 Query: 66 RDIASMVQKKQELQAQNLELKAKKQKISYTRNMEDMQLWNNPMKVNLD 209 R I +M ++EL AQNLELK K+Q+I+ TRNM+D+ LWNN M++N D Sbjct: 151 RKIKAMENHREELIAQNLELKRKRQEIN-TRNMDDLHLWNNSMRMNRD 197