BLASTX nr result
ID: Chrysanthemum21_contig00005139
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00005139 (560 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_022029661.1| NADH dehydrogenase [ubiquinone] iron-sulfur ... 86 2e-18 ref|XP_023770257.1| NADH dehydrogenase [ubiquinone] iron-sulfur ... 86 2e-18 ref|XP_012858460.1| PREDICTED: NADH dehydrogenase [ubiquinone] i... 85 6e-18 ref|XP_017237997.1| PREDICTED: NADH dehydrogenase [ubiquinone] i... 84 1e-17 ref|XP_010525047.1| PREDICTED: NADH dehydrogenase [ubiquinone] i... 84 1e-17 ref|XP_010558646.1| PREDICTED: NADH dehydrogenase [ubiquinone] i... 84 1e-17 ref|XP_011007165.1| PREDICTED: NADH dehydrogenase [ubiquinone] i... 84 2e-17 ref|NP_001336721.1| zinc-finger domain-containing protein [Glyci... 83 2e-17 ref|XP_006298755.2| NADH dehydrogenase [ubiquinone] iron-sulfur ... 83 2e-17 gb|KZV42915.1| NADH dehydrogenase, partial [Dorcoceras hygrometr... 82 3e-17 gb|AFK34710.1| unknown [Medicago truncatula] 83 3e-17 dbj|GAU49397.1| hypothetical protein TSUD_92430 [Trifolium subte... 82 3e-17 ref|XP_021648821.1| NADH dehydrogenase [ubiquinone] iron-sulfur ... 82 3e-17 ref|XP_020214686.1| NADH dehydrogenase [ubiquinone] iron-sulfur ... 82 4e-17 gb|ABS72192.1| mitochondrial NADH-ubiquinone oxidoreductase [Cor... 82 4e-17 ref|NP_566191.1| NADH-ubiquinone oxidoreductase-like protein [Ar... 82 5e-17 ref|XP_011084612.1| NADH dehydrogenase [ubiquinone] iron-sulfur ... 82 5e-17 ref|XP_010942737.1| PREDICTED: NADH dehydrogenase [ubiquinone] i... 82 5e-17 ref|XP_008362822.1| PREDICTED: NADH dehydrogenase [ubiquinone] i... 82 5e-17 ref|XP_007131526.1| hypothetical protein PHAVU_011G020300g [Phas... 82 5e-17 >ref|XP_022029661.1| NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial [Helianthus annuus] gb|OTG32598.1| putative NADH-ubiquinone oxidoreductase-related protein [Helianthus annuus] Length = 113 Score = 85.9 bits (211), Expect = 2e-18 Identities = 35/37 (94%), Positives = 37/37 (100%) Frame = -2 Query: 559 GDTDPALGHPIEFICLDKSEPAICKYCGLRYVQDHHH 449 GDT+PALGHPIEFICLDKSEPA+CKYCGLRYVQDHHH Sbjct: 77 GDTNPALGHPIEFICLDKSEPAVCKYCGLRYVQDHHH 113 >ref|XP_023770257.1| NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial [Lactuca sativa] gb|PLY99727.1| hypothetical protein LSAT_9X47480 [Lactuca sativa] Length = 114 Score = 85.9 bits (211), Expect = 2e-18 Identities = 35/37 (94%), Positives = 37/37 (100%) Frame = -2 Query: 559 GDTDPALGHPIEFICLDKSEPAICKYCGLRYVQDHHH 449 GDT+PALGHPIEFICLDKSEPA+CKYCGLRYVQDHHH Sbjct: 78 GDTNPALGHPIEFICLDKSEPAVCKYCGLRYVQDHHH 114 >ref|XP_012858460.1| PREDICTED: NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial [Erythranthe guttata] gb|EYU19737.1| hypothetical protein MIMGU_mgv1a016696mg [Erythranthe guttata] Length = 111 Score = 84.7 bits (208), Expect = 6e-18 Identities = 34/37 (91%), Positives = 36/37 (97%) Frame = -2 Query: 559 GDTDPALGHPIEFICLDKSEPAICKYCGLRYVQDHHH 449 GD DPALGHPIEFICLDK+EPA+CKYCGLRYVQDHHH Sbjct: 75 GDNDPALGHPIEFICLDKAEPAVCKYCGLRYVQDHHH 111 >ref|XP_017237997.1| PREDICTED: NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial [Daucus carota subsp. sativus] gb|KZN00256.1| hypothetical protein DCAR_009010 [Daucus carota subsp. sativus] Length = 121 Score = 84.3 bits (207), Expect = 1e-17 Identities = 34/37 (91%), Positives = 36/37 (97%) Frame = -2 Query: 559 GDTDPALGHPIEFICLDKSEPAICKYCGLRYVQDHHH 449 GDT+PALGHPIEFICLDK EPA+CKYCGLRYVQDHHH Sbjct: 85 GDTNPALGHPIEFICLDKDEPAVCKYCGLRYVQDHHH 121 >ref|XP_010525047.1| PREDICTED: NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial-like [Tarenaya hassleriana] Length = 102 Score = 83.6 bits (205), Expect = 1e-17 Identities = 34/37 (91%), Positives = 35/37 (94%) Frame = -2 Query: 559 GDTDPALGHPIEFICLDKSEPAICKYCGLRYVQDHHH 449 GDTDPALGHPIEFICLD EPA+CKYCGLRYVQDHHH Sbjct: 66 GDTDPALGHPIEFICLDLDEPAVCKYCGLRYVQDHHH 102 >ref|XP_010558646.1| PREDICTED: NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial-like [Tarenaya hassleriana] Length = 102 Score = 83.6 bits (205), Expect = 1e-17 Identities = 34/37 (91%), Positives = 35/37 (94%) Frame = -2 Query: 559 GDTDPALGHPIEFICLDKSEPAICKYCGLRYVQDHHH 449 GDTDPALGHPIEFICLD EPA+CKYCGLRYVQDHHH Sbjct: 66 GDTDPALGHPIEFICLDLDEPAVCKYCGLRYVQDHHH 102 >ref|XP_011007165.1| PREDICTED: NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial [Populus euphratica] Length = 109 Score = 83.6 bits (205), Expect = 2e-17 Identities = 34/37 (91%), Positives = 35/37 (94%) Frame = -2 Query: 559 GDTDPALGHPIEFICLDKSEPAICKYCGLRYVQDHHH 449 GDTDPALGHPIEFICLD EPA+CKYCGLRYVQDHHH Sbjct: 73 GDTDPALGHPIEFICLDLKEPAVCKYCGLRYVQDHHH 109 >ref|NP_001336721.1| zinc-finger domain-containing protein [Glycine max] gb|KHN05532.1| NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial [Glycine soja] gb|KRH29005.1| hypothetical protein GLYMA_11G091800 [Glycine max] gb|KRH29006.1| hypothetical protein GLYMA_11G091800 [Glycine max] Length = 105 Score = 83.2 bits (204), Expect = 2e-17 Identities = 34/37 (91%), Positives = 35/37 (94%) Frame = -2 Query: 559 GDTDPALGHPIEFICLDKSEPAICKYCGLRYVQDHHH 449 GDTDPALGHPIEFICLD EPA+CKYCGLRYVQDHHH Sbjct: 69 GDTDPALGHPIEFICLDLPEPAVCKYCGLRYVQDHHH 105 >ref|XP_006298755.2| NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial [Capsella rubella] Length = 110 Score = 83.2 bits (204), Expect = 2e-17 Identities = 34/37 (91%), Positives = 36/37 (97%) Frame = -2 Query: 559 GDTDPALGHPIEFICLDKSEPAICKYCGLRYVQDHHH 449 GDT+PALGHPIEFICLD+ EPAICKYCGLRYVQDHHH Sbjct: 74 GDTNPALGHPIEFICLDQDEPAICKYCGLRYVQDHHH 110 >gb|KZV42915.1| NADH dehydrogenase, partial [Dorcoceras hygrometricum] Length = 64 Score = 81.6 bits (200), Expect = 3e-17 Identities = 33/37 (89%), Positives = 34/37 (91%) Frame = -2 Query: 559 GDTDPALGHPIEFICLDKSEPAICKYCGLRYVQDHHH 449 GD DPALGHPIEFICLDK EPA CKYCGLRY+QDHHH Sbjct: 28 GDNDPALGHPIEFICLDKDEPATCKYCGLRYLQDHHH 64 >gb|AFK34710.1| unknown [Medicago truncatula] Length = 105 Score = 82.8 bits (203), Expect = 3e-17 Identities = 33/37 (89%), Positives = 36/37 (97%) Frame = -2 Query: 559 GDTDPALGHPIEFICLDKSEPAICKYCGLRYVQDHHH 449 GDTDPALGHPIE+ICLD +EPA+CKYCGLRYVQDHHH Sbjct: 69 GDTDPALGHPIEYICLDLAEPAVCKYCGLRYVQDHHH 105 >dbj|GAU49397.1| hypothetical protein TSUD_92430 [Trifolium subterraneum] Length = 68 Score = 81.6 bits (200), Expect = 3e-17 Identities = 32/37 (86%), Positives = 36/37 (97%) Frame = -2 Query: 559 GDTDPALGHPIEFICLDKSEPAICKYCGLRYVQDHHH 449 GDTDPALGHPIE+ICLD ++PA+CKYCGLRYVQDHHH Sbjct: 32 GDTDPALGHPIEYICLDLAQPAVCKYCGLRYVQDHHH 68 >ref|XP_021648821.1| NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial, partial [Hevea brasiliensis] Length = 70 Score = 81.6 bits (200), Expect = 3e-17 Identities = 33/37 (89%), Positives = 35/37 (94%) Frame = -2 Query: 559 GDTDPALGHPIEFICLDKSEPAICKYCGLRYVQDHHH 449 GDT+PALGHPIEFICLD EPA+CKYCGLRYVQDHHH Sbjct: 34 GDTNPALGHPIEFICLDLKEPAVCKYCGLRYVQDHHH 70 >ref|XP_020214686.1| NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial [Cajanus cajan] gb|KYP68012.1| hypothetical protein KK1_021629 [Cajanus cajan] Length = 103 Score = 82.4 bits (202), Expect = 4e-17 Identities = 34/37 (91%), Positives = 36/37 (97%) Frame = -2 Query: 559 GDTDPALGHPIEFICLDKSEPAICKYCGLRYVQDHHH 449 GDT+PALGHPIEFICLD +EPAICKYCGLRYVQDHHH Sbjct: 67 GDTNPALGHPIEFICLDLAEPAICKYCGLRYVQDHHH 103 >gb|ABS72192.1| mitochondrial NADH-ubiquinone oxidoreductase [Corchorus olitorius] gb|OMP01523.1| Zinc finger, CHCC-type [Corchorus olitorius] Length = 103 Score = 82.4 bits (202), Expect = 4e-17 Identities = 32/37 (86%), Positives = 36/37 (97%) Frame = -2 Query: 559 GDTDPALGHPIEFICLDKSEPAICKYCGLRYVQDHHH 449 GDT+PALGHPIEFICLDK EPA+CKYCGLRY+Q+HHH Sbjct: 67 GDTNPALGHPIEFICLDKKEPAVCKYCGLRYIQEHHH 103 >ref|NP_566191.1| NADH-ubiquinone oxidoreductase-like protein [Arabidopsis thaliana] sp|Q9M9M6.1|NDUS6_ARATH RecName: Full=NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial; Flags: Precursor gb|AAF26117.1|AC012328_20 unknown protein [Arabidopsis thaliana] gb|AAG40391.1|AF325039_1 AT3g03070 [Arabidopsis thaliana] gb|AAM65015.1| unknown [Arabidopsis thaliana] gb|AAO42820.1| At3g03070 [Arabidopsis thaliana] dbj|BAE99941.1| hypothetical protein [Arabidopsis thaliana] gb|AEE73898.1| NADH-ubiquinone oxidoreductase-like protein [Arabidopsis thaliana] gb|OAP01749.1| hypothetical protein AXX17_AT3G02390 [Arabidopsis thaliana] Length = 110 Score = 82.4 bits (202), Expect = 5e-17 Identities = 34/37 (91%), Positives = 36/37 (97%) Frame = -2 Query: 559 GDTDPALGHPIEFICLDKSEPAICKYCGLRYVQDHHH 449 GDT+PALGHPIEFICLD +EPAICKYCGLRYVQDHHH Sbjct: 74 GDTNPALGHPIEFICLDLNEPAICKYCGLRYVQDHHH 110 >ref|XP_011084612.1| NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial [Sesamum indicum] Length = 111 Score = 82.4 bits (202), Expect = 5e-17 Identities = 33/37 (89%), Positives = 35/37 (94%) Frame = -2 Query: 559 GDTDPALGHPIEFICLDKSEPAICKYCGLRYVQDHHH 449 GD +PALGHPIEFICLDK EPA+CKYCGLRYVQDHHH Sbjct: 75 GDNNPALGHPIEFICLDKEEPAVCKYCGLRYVQDHHH 111 >ref|XP_010942737.1| PREDICTED: NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial [Elaeis guineensis] Length = 102 Score = 82.0 bits (201), Expect = 5e-17 Identities = 32/37 (86%), Positives = 36/37 (97%) Frame = -2 Query: 559 GDTDPALGHPIEFICLDKSEPAICKYCGLRYVQDHHH 449 GDT+PALGHPIEFICLD+ EPA+CKYCGLRY+QDHHH Sbjct: 66 GDTNPALGHPIEFICLDRDEPAVCKYCGLRYLQDHHH 102 >ref|XP_008362822.1| PREDICTED: NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial-like [Malus domestica] ref|XP_009351830.1| PREDICTED: NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial [Pyrus x bretschneideri] Length = 103 Score = 82.0 bits (201), Expect = 5e-17 Identities = 34/37 (91%), Positives = 35/37 (94%) Frame = -2 Query: 559 GDTDPALGHPIEFICLDKSEPAICKYCGLRYVQDHHH 449 GDT+PALGHPIEFICLD EPAICKYCGLRYVQDHHH Sbjct: 67 GDTNPALGHPIEFICLDLDEPAICKYCGLRYVQDHHH 103 >ref|XP_007131526.1| hypothetical protein PHAVU_011G020300g [Phaseolus vulgaris] gb|ESW03520.1| hypothetical protein PHAVU_011G020300g [Phaseolus vulgaris] Length = 103 Score = 82.0 bits (201), Expect = 5e-17 Identities = 33/37 (89%), Positives = 36/37 (97%) Frame = -2 Query: 559 GDTDPALGHPIEFICLDKSEPAICKYCGLRYVQDHHH 449 GDT+PALGHPIEFICLD +EPA+CKYCGLRYVQDHHH Sbjct: 67 GDTNPALGHPIEFICLDLAEPAVCKYCGLRYVQDHHH 103