BLASTX nr result
ID: Chrysanthemum21_contig00004933
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00004933 (527 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_023743616.1| mediator of RNA polymerase II transcription ... 65 6e-09 ref|XP_022025905.1| transcriptional activator ptaB-like isoform ... 64 1e-08 ref|XP_022025904.1| transcriptional activator ptaB-like isoform ... 64 1e-08 gb|OMO96771.1| hypothetical protein CCACVL1_04779, partial [Corc... 61 2e-08 gb|KZV30284.1| hypothetical protein F511_34300 [Dorcoceras hygro... 63 2e-08 gb|PIN19277.1| Non-specific serine/threonine protein kinase [Han... 62 4e-08 ref|XP_022022276.1| vacuolar protein sorting-associated protein ... 62 5e-08 ref|XP_016193038.1| putative uncharacterized protein DDB_G029419... 61 5e-08 ref|XP_021900995.1| trithorax group protein osa [Carica papaya] 62 5e-08 gb|PNY06119.1| hypothetical protein L195_g002581 [Trifolium prat... 62 6e-08 ref|XP_020971205.1| putative mediator of RNA polymerase II trans... 61 7e-08 gb|KVH96655.1| Protein of unknown function DUF1421 [Cynara cardu... 62 7e-08 ref|XP_019449021.1| PREDICTED: histone acetyltransferase p300-li... 62 7e-08 ref|XP_016497836.1| PREDICTED: vacuolar protein sorting-associat... 61 9e-08 ref|XP_021827192.1| extensin isoform X3 [Prunus avium] 61 1e-07 ref|XP_021827191.1| trithorax group protein osa isoform X2 [Prun... 61 1e-07 ref|XP_021827190.1| trithorax group protein osa isoform X1 [Prun... 61 1e-07 ref|XP_020237592.1| trithorax group protein osa-like isoform X2 ... 61 1e-07 ref|XP_017433307.1| PREDICTED: formin-like protein 7 [Vigna angu... 61 1e-07 ref|XP_019260534.1| PREDICTED: ataxin-2 homolog [Nicotiana atten... 61 1e-07 >ref|XP_023743616.1| mediator of RNA polymerase II transcription subunit 15 [Lactuca sativa] Length = 457 Score = 64.7 bits (156), Expect = 6e-09 Identities = 34/57 (59%), Positives = 37/57 (64%) Frame = +2 Query: 71 HKNKVHRSVQILRDKQELADTQKELAKLQLAQKDXXXXXXXXXXXXXXLTPDAKKND 241 H +VHRSVQILRDKQELADTQKELAKLQLA K+ TPD KK + Sbjct: 139 HLQEVHRSVQILRDKQELADTQKELAKLQLANKESSSSHNSQQNEERSSTPDTKKTE 195 >ref|XP_022025905.1| transcriptional activator ptaB-like isoform X2 [Helianthus annuus] Length = 434 Score = 63.9 bits (154), Expect = 1e-08 Identities = 40/97 (41%), Positives = 55/97 (56%), Gaps = 6/97 (6%) Frame = +2 Query: 71 HKNKVHRSVQILRDKQELADTQKELAKLQLAQKDXXXXXXXXXXXXXXLTPDAKKND--- 241 H +V+RSVQILRDKQELADTQKELAKL+LA+K+ TPD +KN+ Sbjct: 120 HLQEVNRSVQILRDKQELADTQKELAKLKLARKESSSSHNSQQNDDRSSTPDTRKNESHG 179 Query: 242 ---RLIVRPIPLVSN*LLPFPVKWPHHHHLQPPNSKW 343 L+ P P P P+ P ++L P ++++ Sbjct: 180 QQLALVPAPQPAPVPAAQP-PMTQPQAYYLPPGSTQY 215 >ref|XP_022025904.1| transcriptional activator ptaB-like isoform X1 [Helianthus annuus] gb|OTF86836.1| putative protein of unknown function DUF1421 [Helianthus annuus] Length = 435 Score = 63.9 bits (154), Expect = 1e-08 Identities = 40/97 (41%), Positives = 55/97 (56%), Gaps = 6/97 (6%) Frame = +2 Query: 71 HKNKVHRSVQILRDKQELADTQKELAKLQLAQKDXXXXXXXXXXXXXXLTPDAKKND--- 241 H +V+RSVQILRDKQELADTQKELAKL+LA+K+ TPD +KN+ Sbjct: 121 HLQEVNRSVQILRDKQELADTQKELAKLKLARKESSSSHNSQQNDDRSSTPDTRKNESHG 180 Query: 242 ---RLIVRPIPLVSN*LLPFPVKWPHHHHLQPPNSKW 343 L+ P P P P+ P ++L P ++++ Sbjct: 181 QQLALVPAPQPAPVPAAQP-PMTQPQAYYLPPGSTQY 216 >gb|OMO96771.1| hypothetical protein CCACVL1_04779, partial [Corchorus capsularis] Length = 179 Score = 61.2 bits (147), Expect = 2e-08 Identities = 30/34 (88%), Positives = 32/34 (94%) Frame = +2 Query: 71 HKNKVHRSVQILRDKQELADTQKELAKLQLAQKD 172 H +VHRSVQILRDKQELADTQKELAKLQLAQK+ Sbjct: 86 HLQEVHRSVQILRDKQELADTQKELAKLQLAQKE 119 >gb|KZV30284.1| hypothetical protein F511_34300 [Dorcoceras hygrometricum] Length = 541 Score = 63.2 bits (152), Expect = 2e-08 Identities = 31/34 (91%), Positives = 32/34 (94%) Frame = +2 Query: 71 HKNKVHRSVQILRDKQELADTQKELAKLQLAQKD 172 H +VHRSVQILRDKQELADTQKELAKLQLAQKD Sbjct: 146 HMQEVHRSVQILRDKQELADTQKELAKLQLAQKD 179 >gb|PIN19277.1| Non-specific serine/threonine protein kinase [Handroanthus impetiginosus] Length = 528 Score = 62.4 bits (150), Expect = 4e-08 Identities = 35/59 (59%), Positives = 40/59 (67%), Gaps = 2/59 (3%) Frame = +2 Query: 71 HKNKVHRSVQILRDKQELADTQKELAKLQLAQKDXXXXXXXXXXXXXXLTP--DAKKND 241 H +VHR+VQILRDKQELADTQKELAKLQLAQK+ TP +AKK+D Sbjct: 144 HVQEVHRAVQILRDKQELADTQKELAKLQLAQKEVPSASNTQQIDDRASTPATEAKKSD 202 >ref|XP_022022276.1| vacuolar protein sorting-associated protein 27-like [Helianthus annuus] gb|OTF86835.1| Protein of unknown function (DUF1421) [Helianthus annuus] Length = 490 Score = 62.0 bits (149), Expect = 5e-08 Identities = 41/94 (43%), Positives = 49/94 (52%), Gaps = 8/94 (8%) Frame = +2 Query: 71 HKNKVHRSVQILRDKQELADTQKELAKLQLAQKDXXXXXXXXXXXXXXLTPDAKKND--- 241 H +VHRSVQILRDKQELADTQKELAKLQLAQK+ TPD +K + Sbjct: 138 HVQEVHRSVQILRDKQELADTQKELAKLQLAQKESSSSSSQQNEEGSS-TPDGRKKESSP 196 Query: 242 -----RLIVRPIPLVSN*LLPFPVKWPHHHHLQP 328 +L + P P P P ++L P Sbjct: 197 DSHGQQLALVPAPQPQRTPEPVAQPQPQAYYLPP 230 >ref|XP_016193038.1| putative uncharacterized protein DDB_G0294196 [Arachis ipaensis] Length = 263 Score = 61.2 bits (147), Expect = 5e-08 Identities = 30/34 (88%), Positives = 32/34 (94%) Frame = +2 Query: 71 HKNKVHRSVQILRDKQELADTQKELAKLQLAQKD 172 H +VHRSVQILRDKQELADTQKELAKLQLAQK+ Sbjct: 82 HLQEVHRSVQILRDKQELADTQKELAKLQLAQKE 115 >ref|XP_021900995.1| trithorax group protein osa [Carica papaya] Length = 568 Score = 62.0 bits (149), Expect = 5e-08 Identities = 42/92 (45%), Positives = 48/92 (52%), Gaps = 2/92 (2%) Frame = +2 Query: 71 HKNKVHRSVQILRDKQELADTQKELAKLQLAQKD--XXXXXXXXXXXXXXLTPDAKKNDR 244 H +VHRSVQILRDKQELAD QKELAKLQLAQK+ L ++KKND Sbjct: 146 HLQEVHRSVQILRDKQELADAQKELAKLQLAQKESSSLSNSQSSEERTTTLAIESKKNDN 205 Query: 245 LIVRPIPLVSN*LLPFPVKWPHHHHLQPPNSK 340 P L P + H PPNS+ Sbjct: 206 ---APDMHNQQLALALPHQVAPQQHTLPPNSQ 234 >gb|PNY06119.1| hypothetical protein L195_g002581 [Trifolium pratense] Length = 378 Score = 61.6 bits (148), Expect = 6e-08 Identities = 30/33 (90%), Positives = 33/33 (100%) Frame = +2 Query: 74 KNKVHRSVQILRDKQELADTQKELAKLQLAQKD 172 KN+VHRSVQILRDKQELA+TQKELAKLQLAQK+ Sbjct: 2 KNQVHRSVQILRDKQELAETQKELAKLQLAQKE 34 >ref|XP_020971205.1| putative mediator of RNA polymerase II transcription subunit 12 [Arachis ipaensis] Length = 296 Score = 61.2 bits (147), Expect = 7e-08 Identities = 30/34 (88%), Positives = 32/34 (94%) Frame = +2 Query: 71 HKNKVHRSVQILRDKQELADTQKELAKLQLAQKD 172 H +VHRSVQILRDKQELADTQKELAKLQLAQK+ Sbjct: 82 HLQEVHRSVQILRDKQELADTQKELAKLQLAQKE 115 >gb|KVH96655.1| Protein of unknown function DUF1421 [Cynara cardunculus var. scolymus] Length = 508 Score = 61.6 bits (148), Expect = 7e-08 Identities = 34/58 (58%), Positives = 38/58 (65%), Gaps = 1/58 (1%) Frame = +2 Query: 71 HKNKVHRSVQILRDKQELADTQKELAKLQLAQKDXXXXXXXXXXXXXXLTP-DAKKND 241 H +VHRSVQI+RDKQELADTQKELAKLQLAQK+ P D K+ND Sbjct: 138 HLQEVHRSVQIIRDKQELADTQKELAKLQLAQKESSAGHDSQKSGETSPVPSDTKRND 195 >ref|XP_019449021.1| PREDICTED: histone acetyltransferase p300-like [Lupinus angustifolius] gb|OIW08368.1| hypothetical protein TanjilG_03044 [Lupinus angustifolius] Length = 517 Score = 61.6 bits (148), Expect = 7e-08 Identities = 36/59 (61%), Positives = 38/59 (64%), Gaps = 2/59 (3%) Frame = +2 Query: 71 HKNKVHRSVQILRDKQELADTQKELAKLQLAQKDXXXXXXXXXXXXXXL--TPDAKKND 241 H +VHRSVQILRDKQELA+TQKELAKLQLAQKD L T D KK D Sbjct: 137 HIQEVHRSVQILRDKQELAETQKELAKLQLAQKDSSSSSLSQSNAERSLPSTTDPKKTD 195 >ref|XP_016497836.1| PREDICTED: vacuolar protein sorting-associated protein 27-like, partial [Nicotiana tabacum] Length = 474 Score = 61.2 bits (147), Expect = 9e-08 Identities = 30/34 (88%), Positives = 32/34 (94%) Frame = +2 Query: 71 HKNKVHRSVQILRDKQELADTQKELAKLQLAQKD 172 H +VHRSVQILRDKQELA+TQKELAKLQLAQKD Sbjct: 144 HVQEVHRSVQILRDKQELAETQKELAKLQLAQKD 177 >ref|XP_021827192.1| extensin isoform X3 [Prunus avium] Length = 528 Score = 61.2 bits (147), Expect = 1e-07 Identities = 30/33 (90%), Positives = 32/33 (96%) Frame = +2 Query: 71 HKNKVHRSVQILRDKQELADTQKELAKLQLAQK 169 H N+VHRSVQILRDKQELA+TQKELAKLQLAQK Sbjct: 144 HLNEVHRSVQILRDKQELAETQKELAKLQLAQK 176 >ref|XP_021827191.1| trithorax group protein osa isoform X2 [Prunus avium] Length = 529 Score = 61.2 bits (147), Expect = 1e-07 Identities = 30/33 (90%), Positives = 32/33 (96%) Frame = +2 Query: 71 HKNKVHRSVQILRDKQELADTQKELAKLQLAQK 169 H N+VHRSVQILRDKQELA+TQKELAKLQLAQK Sbjct: 145 HLNEVHRSVQILRDKQELAETQKELAKLQLAQK 177 >ref|XP_021827190.1| trithorax group protein osa isoform X1 [Prunus avium] Length = 530 Score = 61.2 bits (147), Expect = 1e-07 Identities = 30/33 (90%), Positives = 32/33 (96%) Frame = +2 Query: 71 HKNKVHRSVQILRDKQELADTQKELAKLQLAQK 169 H N+VHRSVQILRDKQELA+TQKELAKLQLAQK Sbjct: 146 HLNEVHRSVQILRDKQELAETQKELAKLQLAQK 178 >ref|XP_020237592.1| trithorax group protein osa-like isoform X2 [Cajanus cajan] Length = 533 Score = 61.2 bits (147), Expect = 1e-07 Identities = 30/34 (88%), Positives = 32/34 (94%) Frame = +2 Query: 71 HKNKVHRSVQILRDKQELADTQKELAKLQLAQKD 172 H +VHRSVQILRDKQELADTQKELAKLQLAQK+ Sbjct: 137 HLQEVHRSVQILRDKQELADTQKELAKLQLAQKE 170 >ref|XP_017433307.1| PREDICTED: formin-like protein 7 [Vigna angularis] dbj|BAT90129.1| hypothetical protein VIGAN_06131200 [Vigna angularis var. angularis] Length = 533 Score = 61.2 bits (147), Expect = 1e-07 Identities = 30/34 (88%), Positives = 32/34 (94%) Frame = +2 Query: 71 HKNKVHRSVQILRDKQELADTQKELAKLQLAQKD 172 H +VHRSVQILRDKQELADTQKELAKLQLAQK+ Sbjct: 137 HLQEVHRSVQILRDKQELADTQKELAKLQLAQKE 170 >ref|XP_019260534.1| PREDICTED: ataxin-2 homolog [Nicotiana attenuata] gb|OIT39112.1| hypothetical protein A4A49_11450 [Nicotiana attenuata] Length = 535 Score = 61.2 bits (147), Expect = 1e-07 Identities = 30/34 (88%), Positives = 32/34 (94%) Frame = +2 Query: 71 HKNKVHRSVQILRDKQELADTQKELAKLQLAQKD 172 H +VHRSVQILRDKQELA+TQKELAKLQLAQKD Sbjct: 144 HVQEVHRSVQILRDKQELAETQKELAKLQLAQKD 177