BLASTX nr result
ID: Chrysanthemum21_contig00004912
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00004912 (463 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KVH90256.1| hypothetical protein Ccrd_007749 [Cynara carduncu... 81 8e-16 ref|XP_023747027.1| deSI-like protein At4g17486 [Lactuca sativa]... 78 9e-15 ref|XP_022023058.1| deSI-like protein At4g17486 isoform X1 [Heli... 78 9e-15 ref|XP_022001097.1| deSI-like protein At4g17486 [Helianthus annu... 78 1e-14 ref|XP_021769419.1| deSI-like protein At4g17486 [Chenopodium qui... 74 4e-13 ref|XP_021739444.1| deSI-like protein At4g17486 [Chenopodium qui... 74 4e-13 ref|XP_021857059.1| deSI-like protein At4g17486 [Spinacia olerac... 74 4e-13 emb|CBI21088.3| unnamed protein product, partial [Vitis vinifera] 73 4e-13 ref|XP_010245553.1| PREDICTED: deSI-like protein At4g17486 [Nelu... 74 6e-13 gb|PHT40316.1| DeSI-like protein [Capsicum baccatum] 73 7e-13 ref|XP_016546453.1| PREDICTED: deSI-like protein At4g17486 [Caps... 73 7e-13 ref|XP_010648702.1| PREDICTED: deSI-like protein At4g17486 [Viti... 73 1e-12 ref|XP_021640846.1| deSI-like protein At4g17486 [Hevea brasilien... 73 1e-12 gb|PHU09089.1| DeSI-like protein [Capsicum chinense] 73 2e-12 ref|XP_021677816.1| deSI-like protein At4g17486 [Hevea brasilien... 72 2e-12 ref|XP_019262889.1| PREDICTED: deSI-like protein At4g17486 [Nico... 72 3e-12 ref|XP_009593660.1| PREDICTED: deSI-like protein At4g17486 [Nico... 72 3e-12 ref|XP_002515452.1| PREDICTED: deSI-like protein At4g17486 [Rici... 72 3e-12 ref|XP_009794916.1| PREDICTED: deSI-like protein At4g17486 [Nico... 70 4e-12 ref|XP_012843468.1| PREDICTED: deSI-like protein At4g17486 [Eryt... 71 4e-12 >gb|KVH90256.1| hypothetical protein Ccrd_007749 [Cynara cardunculus var. scolymus] Length = 214 Score = 80.9 bits (198), Expect = 8e-16 Identities = 36/38 (94%), Positives = 37/38 (97%) Frame = +3 Query: 348 LKMLCRMIARKKKTGTVPVYLNVYDLTPINGYAYWVGL 461 +KMLCRMI RKKKTGTVPVYLNVYDLTPINGYAYWVGL Sbjct: 1 MKMLCRMIPRKKKTGTVPVYLNVYDLTPINGYAYWVGL 38 >ref|XP_023747027.1| deSI-like protein At4g17486 [Lactuca sativa] gb|PLY63763.1| hypothetical protein LSAT_6X19821 [Lactuca sativa] Length = 216 Score = 78.2 bits (191), Expect = 9e-15 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = +3 Query: 354 MLCRMIARKKKTGTVPVYLNVYDLTPINGYAYWVGL 461 MLCRMI RKKKTGTVPVYLNVYDLTPINGYAYWVGL Sbjct: 1 MLCRMIPRKKKTGTVPVYLNVYDLTPINGYAYWVGL 36 >ref|XP_022023058.1| deSI-like protein At4g17486 isoform X1 [Helianthus annuus] gb|OTG34826.1| putative PPPDE putative peptidase domain-containing protein [Helianthus annuus] Length = 219 Score = 78.2 bits (191), Expect = 9e-15 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = +3 Query: 354 MLCRMIARKKKTGTVPVYLNVYDLTPINGYAYWVGL 461 MLCRMI RKKKTGTVPVYLNVYDLTPINGYAYWVGL Sbjct: 1 MLCRMIPRKKKTGTVPVYLNVYDLTPINGYAYWVGL 36 >ref|XP_022001097.1| deSI-like protein At4g17486 [Helianthus annuus] gb|OTG01585.1| putative PPPDE putative thiol peptidase family protein [Helianthus annuus] Length = 207 Score = 77.8 bits (190), Expect = 1e-14 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = +3 Query: 354 MLCRMIARKKKTGTVPVYLNVYDLTPINGYAYWVGL 461 MLCRMI RKKKTGTVPVYLNVYDLTPINGYAYWVGL Sbjct: 1 MLCRMIHRKKKTGTVPVYLNVYDLTPINGYAYWVGL 36 >ref|XP_021769419.1| deSI-like protein At4g17486 [Chenopodium quinoa] Length = 227 Score = 73.9 bits (180), Expect = 4e-13 Identities = 32/36 (88%), Positives = 34/36 (94%) Frame = +3 Query: 354 MLCRMIARKKKTGTVPVYLNVYDLTPINGYAYWVGL 461 MLCRMI +KKKTG VPVYLNVYDLTPINGYAYW+GL Sbjct: 1 MLCRMIPKKKKTGAVPVYLNVYDLTPINGYAYWLGL 36 >ref|XP_021739444.1| deSI-like protein At4g17486 [Chenopodium quinoa] Length = 227 Score = 73.9 bits (180), Expect = 4e-13 Identities = 32/36 (88%), Positives = 34/36 (94%) Frame = +3 Query: 354 MLCRMIARKKKTGTVPVYLNVYDLTPINGYAYWVGL 461 MLCRMI +KKKTG VPVYLNVYDLTPINGYAYW+GL Sbjct: 1 MLCRMIPKKKKTGAVPVYLNVYDLTPINGYAYWLGL 36 >ref|XP_021857059.1| deSI-like protein At4g17486 [Spinacia oleracea] gb|KNA05002.1| hypothetical protein SOVF_194450 [Spinacia oleracea] Length = 227 Score = 73.9 bits (180), Expect = 4e-13 Identities = 32/36 (88%), Positives = 34/36 (94%) Frame = +3 Query: 354 MLCRMIARKKKTGTVPVYLNVYDLTPINGYAYWVGL 461 MLCRMI +KKKTG VPVYLNVYDLTPINGYAYW+GL Sbjct: 1 MLCRMIPKKKKTGAVPVYLNVYDLTPINGYAYWLGL 36 >emb|CBI21088.3| unnamed protein product, partial [Vitis vinifera] Length = 174 Score = 72.8 bits (177), Expect = 4e-13 Identities = 30/36 (83%), Positives = 36/36 (100%) Frame = +3 Query: 354 MLCRMIARKKKTGTVPVYLNVYDLTPINGYAYWVGL 461 MLCRM++RK+KTG+VPVYLNVYDLTP+NGYAYW+GL Sbjct: 1 MLCRMMSRKRKTGSVPVYLNVYDLTPMNGYAYWLGL 36 >ref|XP_010245553.1| PREDICTED: deSI-like protein At4g17486 [Nelumbo nucifera] Length = 224 Score = 73.6 bits (179), Expect = 6e-13 Identities = 31/36 (86%), Positives = 36/36 (100%) Frame = +3 Query: 354 MLCRMIARKKKTGTVPVYLNVYDLTPINGYAYWVGL 461 MLCR+I+RK+KTG+VPVYLNVYDLTPINGYAYW+GL Sbjct: 1 MLCRVISRKRKTGSVPVYLNVYDLTPINGYAYWLGL 36 >gb|PHT40316.1| DeSI-like protein [Capsicum baccatum] Length = 222 Score = 73.2 bits (178), Expect = 7e-13 Identities = 31/36 (86%), Positives = 34/36 (94%) Frame = +3 Query: 354 MLCRMIARKKKTGTVPVYLNVYDLTPINGYAYWVGL 461 MLCRM+ RK+KTG VPVYLNVYDLTPINGYAYW+GL Sbjct: 1 MLCRMLPRKRKTGVVPVYLNVYDLTPINGYAYWLGL 36 >ref|XP_016546453.1| PREDICTED: deSI-like protein At4g17486 [Capsicum annuum] gb|PHT61438.1| DeSI-like protein [Capsicum annuum] Length = 222 Score = 73.2 bits (178), Expect = 7e-13 Identities = 31/36 (86%), Positives = 34/36 (94%) Frame = +3 Query: 354 MLCRMIARKKKTGTVPVYLNVYDLTPINGYAYWVGL 461 MLCRM+ RK+KTG VPVYLNVYDLTPINGYAYW+GL Sbjct: 1 MLCRMLRRKRKTGVVPVYLNVYDLTPINGYAYWLGL 36 >ref|XP_010648702.1| PREDICTED: deSI-like protein At4g17486 [Vitis vinifera] Length = 226 Score = 72.8 bits (177), Expect = 1e-12 Identities = 30/36 (83%), Positives = 36/36 (100%) Frame = +3 Query: 354 MLCRMIARKKKTGTVPVYLNVYDLTPINGYAYWVGL 461 MLCRM++RK+KTG+VPVYLNVYDLTP+NGYAYW+GL Sbjct: 1 MLCRMMSRKRKTGSVPVYLNVYDLTPMNGYAYWLGL 36 >ref|XP_021640846.1| deSI-like protein At4g17486 [Hevea brasiliensis] Length = 230 Score = 72.8 bits (177), Expect = 1e-12 Identities = 34/38 (89%), Positives = 35/38 (92%), Gaps = 2/38 (5%) Frame = +3 Query: 354 MLCRMIA--RKKKTGTVPVYLNVYDLTPINGYAYWVGL 461 MLCRM+ RKKKTGTVPVYLNVYDLTPINGYAYWVGL Sbjct: 1 MLCRMVLLPRKKKTGTVPVYLNVYDLTPINGYAYWVGL 38 >gb|PHU09089.1| DeSI-like protein [Capsicum chinense] Length = 276 Score = 73.2 bits (178), Expect = 2e-12 Identities = 31/36 (86%), Positives = 34/36 (94%) Frame = +3 Query: 354 MLCRMIARKKKTGTVPVYLNVYDLTPINGYAYWVGL 461 MLCRM+ RK+KTG VPVYLNVYDLTPINGYAYW+GL Sbjct: 1 MLCRMLRRKRKTGVVPVYLNVYDLTPINGYAYWLGL 36 >ref|XP_021677816.1| deSI-like protein At4g17486 [Hevea brasiliensis] Length = 198 Score = 71.6 bits (174), Expect = 2e-12 Identities = 33/38 (86%), Positives = 35/38 (92%), Gaps = 2/38 (5%) Frame = +3 Query: 354 MLCRMIA--RKKKTGTVPVYLNVYDLTPINGYAYWVGL 461 MLCRM+ RKKKTGTVPVYLNVYDLTPINGYAYW+GL Sbjct: 1 MLCRMVLLPRKKKTGTVPVYLNVYDLTPINGYAYWLGL 38 >ref|XP_019262889.1| PREDICTED: deSI-like protein At4g17486 [Nicotiana attenuata] ref|XP_019242236.1| PREDICTED: deSI-like protein At4g17486 [Nicotiana attenuata] gb|OIT18760.1| desi-like protein [Nicotiana attenuata] gb|OIT37504.1| desi-like protein [Nicotiana attenuata] Length = 223 Score = 71.6 bits (174), Expect = 3e-12 Identities = 30/36 (83%), Positives = 34/36 (94%) Frame = +3 Query: 354 MLCRMIARKKKTGTVPVYLNVYDLTPINGYAYWVGL 461 MLC+M+ RK+KTG VPVYLNVYDLTPINGYAYW+GL Sbjct: 1 MLCQMLRRKRKTGAVPVYLNVYDLTPINGYAYWLGL 36 >ref|XP_009593660.1| PREDICTED: deSI-like protein At4g17486 [Nicotiana tomentosiformis] ref|XP_016481023.1| PREDICTED: deSI-like protein At4g17486 [Nicotiana tabacum] Length = 223 Score = 71.6 bits (174), Expect = 3e-12 Identities = 30/36 (83%), Positives = 34/36 (94%) Frame = +3 Query: 354 MLCRMIARKKKTGTVPVYLNVYDLTPINGYAYWVGL 461 MLC+M+ RK+KTG VPVYLNVYDLTPINGYAYW+GL Sbjct: 1 MLCQMLRRKRKTGAVPVYLNVYDLTPINGYAYWLGL 36 >ref|XP_002515452.1| PREDICTED: deSI-like protein At4g17486 [Ricinus communis] gb|EEF46901.1| conserved hypothetical protein [Ricinus communis] Length = 230 Score = 71.6 bits (174), Expect = 3e-12 Identities = 33/38 (86%), Positives = 35/38 (92%), Gaps = 2/38 (5%) Frame = +3 Query: 354 MLCRMIA--RKKKTGTVPVYLNVYDLTPINGYAYWVGL 461 MLCRM+ RKKKTGTVPVYLNVYDLTPINGYAYW+GL Sbjct: 1 MLCRMVLLQRKKKTGTVPVYLNVYDLTPINGYAYWLGL 38 >ref|XP_009794916.1| PREDICTED: deSI-like protein At4g17486 [Nicotiana sylvestris] Length = 161 Score = 70.1 bits (170), Expect = 4e-12 Identities = 29/36 (80%), Positives = 34/36 (94%) Frame = +3 Query: 354 MLCRMIARKKKTGTVPVYLNVYDLTPINGYAYWVGL 461 MLC+++ RK+KTG VPVYLNVYDLTPINGYAYW+GL Sbjct: 1 MLCQILRRKRKTGAVPVYLNVYDLTPINGYAYWLGL 36 >ref|XP_012843468.1| PREDICTED: deSI-like protein At4g17486 [Erythranthe guttata] gb|EYU32380.1| hypothetical protein MIMGU_mgv1a013824mg [Erythranthe guttata] Length = 209 Score = 70.9 bits (172), Expect = 4e-12 Identities = 31/36 (86%), Positives = 34/36 (94%) Frame = +3 Query: 354 MLCRMIARKKKTGTVPVYLNVYDLTPINGYAYWVGL 461 ML R++ RKKKTGTVPVYLNVYDLTPINGYAYW+GL Sbjct: 1 MLSRIMGRKKKTGTVPVYLNVYDLTPINGYAYWLGL 36