BLASTX nr result
ID: Chrysanthemum21_contig00004694
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00004694 (515 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_022011822.1| mitochondrial import inner membrane transloc... 93 4e-19 ref|XP_020553947.1| mitochondrial import inner membrane transloc... 88 5e-18 ref|XP_020553946.1| mitochondrial import inner membrane transloc... 88 7e-18 ref|XP_023736397.1| mitochondrial import inner membrane transloc... 89 1e-17 ref|XP_011095527.1| mitochondrial import inner membrane transloc... 88 2e-17 ref|XP_002264515.1| PREDICTED: mitochondrial import inner membra... 87 5e-17 ref|XP_019251075.1| PREDICTED: mitochondrial import inner membra... 87 7e-17 ref|XP_009764636.1| PREDICTED: mitochondrial import inner membra... 87 7e-17 ref|XP_010274019.1| PREDICTED: mitochondrial import inner membra... 86 1e-16 gb|ABF70066.1| mitochondrial inner membrane preprotein transloca... 80 2e-16 gb|PHU04073.1| Mitochondrial import inner membrane translocase s... 85 2e-16 gb|PHT35501.1| Mitochondrial import inner membrane translocase s... 85 2e-16 ref|XP_016544810.1| PREDICTED: mitochondrial import inner membra... 85 2e-16 gb|PIN11400.1| TFIIF-interacting CTD phosphatase, including NLI-... 85 2e-16 gb|PKA57067.1| Mitochondrial import inner membrane translocase s... 85 3e-16 gb|ONK67428.1| uncharacterized protein A4U43_C06F20150 [Asparagu... 80 3e-16 gb|PIN01979.1| TFIIF-interacting CTD phosphatase, including NLI-... 84 5e-16 ref|XP_015056479.1| PREDICTED: mitochondrial import inner membra... 84 5e-16 ref|XP_004248309.1| PREDICTED: mitochondrial import inner membra... 84 5e-16 gb|KVH96020.1| HAD-like domain-containing protein, partial [Cyna... 85 5e-16 >ref|XP_022011822.1| mitochondrial import inner membrane translocase subunit TIM50-like [Helianthus annuus] ref|XP_022011823.1| mitochondrial import inner membrane translocase subunit TIM50-like [Helianthus annuus] ref|XP_022011824.1| mitochondrial import inner membrane translocase subunit TIM50-like [Helianthus annuus] ref|XP_022011825.1| mitochondrial import inner membrane translocase subunit TIM50-like [Helianthus annuus] gb|OTF94965.1| putative FCP1-like domain, HAD-like domain protein [Helianthus annuus] Length = 364 Score = 92.8 bits (229), Expect = 4e-19 Identities = 43/46 (93%), Positives = 46/46 (100%) Frame = +1 Query: 1 RNRPADIRPVLASYQGRDIAKEFIERNKEHQRKMQEQKQQGRLWRR 138 R+RPADIRPVLASYQGRDIAKEFIER+KEHQ+KMQEQKQQGRLWRR Sbjct: 319 RHRPADIRPVLASYQGRDIAKEFIERSKEHQKKMQEQKQQGRLWRR 364 >ref|XP_020553947.1| mitochondrial import inner membrane translocase subunit TIM50 isoform X3 [Sesamum indicum] Length = 259 Score = 88.2 bits (217), Expect = 5e-18 Identities = 40/46 (86%), Positives = 45/46 (97%) Frame = +1 Query: 1 RNRPADIRPVLASYQGRDIAKEFIERNKEHQRKMQEQKQQGRLWRR 138 ++RPADIR VLASYQGRDIAKEF+ER+KEHQR+MQEQKQQGRLWRR Sbjct: 214 KHRPADIRTVLASYQGRDIAKEFVERSKEHQRRMQEQKQQGRLWRR 259 >ref|XP_020553946.1| mitochondrial import inner membrane translocase subunit TIM50 isoform X2 [Sesamum indicum] Length = 275 Score = 88.2 bits (217), Expect = 7e-18 Identities = 40/46 (86%), Positives = 45/46 (97%) Frame = +1 Query: 1 RNRPADIRPVLASYQGRDIAKEFIERNKEHQRKMQEQKQQGRLWRR 138 ++RPADIR VLASYQGRDIAKEF+ER+KEHQR+MQEQKQQGRLWRR Sbjct: 230 KHRPADIRTVLASYQGRDIAKEFVERSKEHQRRMQEQKQQGRLWRR 275 >ref|XP_023736397.1| mitochondrial import inner membrane translocase subunit TIM50-like [Lactuca sativa] ref|XP_023736398.1| mitochondrial import inner membrane translocase subunit TIM50-like [Lactuca sativa] gb|PLY71835.1| hypothetical protein LSAT_3X47521 [Lactuca sativa] Length = 362 Score = 88.6 bits (218), Expect = 1e-17 Identities = 41/46 (89%), Positives = 44/46 (95%) Frame = +1 Query: 1 RNRPADIRPVLASYQGRDIAKEFIERNKEHQRKMQEQKQQGRLWRR 138 R+RPADIRPVLASYQG DIAKEFIER+KEHQR+MQEQKQ GRLWRR Sbjct: 317 RHRPADIRPVLASYQGHDIAKEFIERSKEHQRRMQEQKQPGRLWRR 362 >ref|XP_011095527.1| mitochondrial import inner membrane translocase subunit TIM50 isoform X1 [Sesamum indicum] Length = 354 Score = 88.2 bits (217), Expect = 2e-17 Identities = 40/46 (86%), Positives = 45/46 (97%) Frame = +1 Query: 1 RNRPADIRPVLASYQGRDIAKEFIERNKEHQRKMQEQKQQGRLWRR 138 ++RPADIR VLASYQGRDIAKEF+ER+KEHQR+MQEQKQQGRLWRR Sbjct: 309 KHRPADIRTVLASYQGRDIAKEFVERSKEHQRRMQEQKQQGRLWRR 354 >ref|XP_002264515.1| PREDICTED: mitochondrial import inner membrane translocase subunit TIM50 [Vitis vinifera] emb|CBI39719.3| unnamed protein product, partial [Vitis vinifera] Length = 371 Score = 87.0 bits (214), Expect = 5e-17 Identities = 40/46 (86%), Positives = 43/46 (93%) Frame = +1 Query: 1 RNRPADIRPVLASYQGRDIAKEFIERNKEHQRKMQEQKQQGRLWRR 138 RNRPADIRPVLASYQG DIAKEFIER+KE+QR+MQEQKQ GR WRR Sbjct: 326 RNRPADIRPVLASYQGHDIAKEFIERSKEYQRRMQEQKQHGRFWRR 371 >ref|XP_019251075.1| PREDICTED: mitochondrial import inner membrane translocase subunit TIM50-like [Nicotiana attenuata] gb|OIT08482.1| mitochondrial import inner membrane translocase subunit tim50 [Nicotiana attenuata] Length = 357 Score = 86.7 bits (213), Expect = 7e-17 Identities = 40/46 (86%), Positives = 43/46 (93%) Frame = +1 Query: 1 RNRPADIRPVLASYQGRDIAKEFIERNKEHQRKMQEQKQQGRLWRR 138 +NRPADIR VLASYQGRDIAKEFIER+KEH R+MQEQKQ GRLWRR Sbjct: 312 KNRPADIRTVLASYQGRDIAKEFIERSKEHHRRMQEQKQHGRLWRR 357 >ref|XP_009764636.1| PREDICTED: mitochondrial import inner membrane translocase subunit TIM50-like [Nicotiana sylvestris] ref|XP_016500059.1| PREDICTED: mitochondrial import inner membrane translocase subunit TIM50-like [Nicotiana tabacum] Length = 366 Score = 86.7 bits (213), Expect = 7e-17 Identities = 40/46 (86%), Positives = 43/46 (93%) Frame = +1 Query: 1 RNRPADIRPVLASYQGRDIAKEFIERNKEHQRKMQEQKQQGRLWRR 138 +NRPADIR VLASYQGRDIAKEFIER+KEH R+MQEQKQ GRLWRR Sbjct: 321 KNRPADIRTVLASYQGRDIAKEFIERSKEHHRRMQEQKQHGRLWRR 366 >ref|XP_010274019.1| PREDICTED: mitochondrial import inner membrane translocase subunit TIM50-like [Nelumbo nucifera] Length = 353 Score = 85.9 bits (211), Expect = 1e-16 Identities = 39/46 (84%), Positives = 43/46 (93%) Frame = +1 Query: 1 RNRPADIRPVLASYQGRDIAKEFIERNKEHQRKMQEQKQQGRLWRR 138 R+RPADIRPVLASYQG DIA EFIER+KEHQR+MQEQKQ GR+WRR Sbjct: 308 RHRPADIRPVLASYQGHDIATEFIERSKEHQRRMQEQKQHGRIWRR 353 >gb|ABF70066.1| mitochondrial inner membrane preprotein translocase (TIM23) component-related [Musa acuminata] Length = 109 Score = 80.5 bits (197), Expect = 2e-16 Identities = 36/45 (80%), Positives = 40/45 (88%) Frame = +1 Query: 4 NRPADIRPVLASYQGRDIAKEFIERNKEHQRKMQEQKQQGRLWRR 138 +RPADIRPVLASY G DIA EFIER+KEHQR+MQ+QKQ GR WRR Sbjct: 65 HRPADIRPVLASYHGHDIASEFIERSKEHQRRMQDQKQHGRFWRR 109 >gb|PHU04073.1| Mitochondrial import inner membrane translocase subunit TIM50 [Capsicum chinense] Length = 357 Score = 85.1 bits (209), Expect = 2e-16 Identities = 39/46 (84%), Positives = 44/46 (95%) Frame = +1 Query: 1 RNRPADIRPVLASYQGRDIAKEFIERNKEHQRKMQEQKQQGRLWRR 138 ++RPADIR VLASYQGRDIAKEFIER+KEHQR++QEQKQ GRLWRR Sbjct: 312 KHRPADIRTVLASYQGRDIAKEFIERSKEHQRRVQEQKQHGRLWRR 357 >gb|PHT35501.1| Mitochondrial import inner membrane translocase subunit TIM50 [Capsicum baccatum] Length = 357 Score = 85.1 bits (209), Expect = 2e-16 Identities = 39/46 (84%), Positives = 44/46 (95%) Frame = +1 Query: 1 RNRPADIRPVLASYQGRDIAKEFIERNKEHQRKMQEQKQQGRLWRR 138 ++RPADIR VLASYQGRDIAKEFIER+KEHQR++QEQKQ GRLWRR Sbjct: 312 KHRPADIRTVLASYQGRDIAKEFIERSKEHQRRVQEQKQHGRLWRR 357 >ref|XP_016544810.1| PREDICTED: mitochondrial import inner membrane translocase subunit TIM50-like [Capsicum annuum] gb|PHT69556.1| Mitochondrial import inner membrane translocase subunit TIM50 [Capsicum annuum] Length = 357 Score = 85.1 bits (209), Expect = 2e-16 Identities = 39/46 (84%), Positives = 44/46 (95%) Frame = +1 Query: 1 RNRPADIRPVLASYQGRDIAKEFIERNKEHQRKMQEQKQQGRLWRR 138 ++RPADIR VLASYQGRDIAKEFIER+KEHQR++QEQKQ GRLWRR Sbjct: 312 KHRPADIRTVLASYQGRDIAKEFIERSKEHQRRVQEQKQHGRLWRR 357 >gb|PIN11400.1| TFIIF-interacting CTD phosphatase, including NLI-interacting factor [Handroanthus impetiginosus] Length = 358 Score = 85.1 bits (209), Expect = 2e-16 Identities = 39/46 (84%), Positives = 44/46 (95%) Frame = +1 Query: 1 RNRPADIRPVLASYQGRDIAKEFIERNKEHQRKMQEQKQQGRLWRR 138 ++RPADIR VLASYQGRDIAKEFIER+K+HQR+MQEQKQQ RLWRR Sbjct: 313 KHRPADIRTVLASYQGRDIAKEFIERSKDHQRRMQEQKQQNRLWRR 358 >gb|PKA57067.1| Mitochondrial import inner membrane translocase subunit TIM50 [Apostasia shenzhenica] Length = 365 Score = 85.1 bits (209), Expect = 3e-16 Identities = 39/45 (86%), Positives = 42/45 (93%) Frame = +1 Query: 4 NRPADIRPVLASYQGRDIAKEFIERNKEHQRKMQEQKQQGRLWRR 138 +RPADIRPVLASYQGRDIA EFIER+KEHQR+MQEQKQ GR WRR Sbjct: 321 HRPADIRPVLASYQGRDIATEFIERSKEHQRRMQEQKQHGRFWRR 365 >gb|ONK67428.1| uncharacterized protein A4U43_C06F20150 [Asparagus officinalis] Length = 105 Score = 79.7 bits (195), Expect = 3e-16 Identities = 35/45 (77%), Positives = 41/45 (91%) Frame = +1 Query: 4 NRPADIRPVLASYQGRDIAKEFIERNKEHQRKMQEQKQQGRLWRR 138 +RPADIRPVLASYQG DIA+EFIER+KEHQ++MQEQ Q GR W+R Sbjct: 61 HRPADIRPVLASYQGHDIAREFIERSKEHQKRMQEQNQHGRFWQR 105 >gb|PIN01979.1| TFIIF-interacting CTD phosphatase, including NLI-interacting factor [Handroanthus impetiginosus] Length = 358 Score = 84.3 bits (207), Expect = 5e-16 Identities = 38/46 (82%), Positives = 44/46 (95%) Frame = +1 Query: 1 RNRPADIRPVLASYQGRDIAKEFIERNKEHQRKMQEQKQQGRLWRR 138 ++RPA+IR V+ASYQGRDIAKEFIER+KEHQR+MQEQKQQGR WRR Sbjct: 313 KHRPAEIRNVIASYQGRDIAKEFIERSKEHQRRMQEQKQQGRFWRR 358 >ref|XP_015056479.1| PREDICTED: mitochondrial import inner membrane translocase subunit TIM50-like [Solanum pennellii] Length = 359 Score = 84.3 bits (207), Expect = 5e-16 Identities = 38/46 (82%), Positives = 43/46 (93%) Frame = +1 Query: 1 RNRPADIRPVLASYQGRDIAKEFIERNKEHQRKMQEQKQQGRLWRR 138 ++RPADIR VLASYQGRDI KEF+ER+KEHQR+MQEQKQ GRLWRR Sbjct: 314 KHRPADIRAVLASYQGRDIPKEFVERSKEHQRRMQEQKQHGRLWRR 359 >ref|XP_004248309.1| PREDICTED: mitochondrial import inner membrane translocase subunit TIM50 [Solanum lycopersicum] Length = 359 Score = 84.3 bits (207), Expect = 5e-16 Identities = 38/46 (82%), Positives = 43/46 (93%) Frame = +1 Query: 1 RNRPADIRPVLASYQGRDIAKEFIERNKEHQRKMQEQKQQGRLWRR 138 ++RPADIR VLASYQGRDI KEF+ER+KEHQR+MQEQKQ GRLWRR Sbjct: 314 KHRPADIRAVLASYQGRDIPKEFVERSKEHQRRMQEQKQHGRLWRR 359 >gb|KVH96020.1| HAD-like domain-containing protein, partial [Cynara cardunculus var. scolymus] Length = 415 Score = 84.7 bits (208), Expect = 5e-16 Identities = 38/46 (82%), Positives = 43/46 (93%) Frame = +1 Query: 1 RNRPADIRPVLASYQGRDIAKEFIERNKEHQRKMQEQKQQGRLWRR 138 R+RPADIRPVL+SY G DIA+EFIER+KEHQR+MQEQKQ GRLWRR Sbjct: 370 RHRPADIRPVLSSYHGHDIAREFIERSKEHQRRMQEQKQHGRLWRR 415